(data stored in ACNUC16935 zone)

EMBL: BN001307.PE339

BN001307.PE339       Location/Qualifiers
FT   CDS_pept        complement(join(929434..929520,929751..930137,
FT                   930172..930276,930376..930381))
FT                   /locus_tag="ANIA_01499"
FT                   /old_locus_tag="AN1499.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008124"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008124"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008124"
FT                   /db_xref="GOA:Q5BD81"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD81"
FT                   /protein_id="CBF84991.1"
FT                   /translation="MSRFLRQDIQRRLLRLLTLKPFRLLPPHGPQAANDEPQCKPSLNH
FT                   YNNRPVLILALIIFIMGPRHFVRCLPDLLLYPPIRLTAPLAPSAFNLQCSTLDPQSRLL
FT                   RRRSLERTSMLTCQRPPQSPTNIEGMLSPPSAIGGVRVTLEILEGFDIDEPPRIPCQNR
FT                   FLKCEAIICLADDTRSRKKIVDGTFAKVVGA"
     atgtcaagat ttttgaggca agatatccaa cgcaggctcc tcaggctcct cactctgaaa        60
     ccattccgtc tactcccacc gcatggacca caagcagcca acgacgaacc tcagtgcaag       120
     ccctcactta accactacaa caatcgaccc gttctcatcc tcgccttgat catctttatc       180
     atgggtcctc gccattttgt ccgatgcctc cccgacctgc tcctataccc tcccatccgc       240
     ctgacagcac cgctggcgcc ctccgccttc aaccttcaat gctcgacgct cgatcctcag       300
     tcccgcctgc tacgacggag atcattagaa cgtacaagca tgcttacatg tcaacggcca       360
     ccacaatctc caacaaacat agaaggaatg ctctcgccgc cctccgcgat aggaggagtc       420
     agagttacac tggagatcct ggaaggtttc gatatcgatg agccccctcg gattccgtgc       480
     caaaaccggt ttctaaagtg tgaggccatc atctgcctgg cagacgacac aagaagccgg       540
     aagaaaatcg tcgacggaac gtttgccaaa gttgtagggg cctga                       585
//

If you have problems or comments...

PBIL Back to PBIL home page