(data stored in ACNUC16935 zone)

EMBL: BN001307.PE34

BN001307.PE34        Location/Qualifiers
FT   CDS_pept        92996..94126
FT                   /locus_tag="ANIA_09028"
FT                   /old_locus_tag="AN9028.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007825"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007825"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007825"
FT                   /db_xref="GOA:Q5ARQ2"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARQ2"
FT                   /protein_id="CBF84432.1"
FT                   /translation="MAKTALITGANGITGSAILEYLVKNTTASEWERIIITSRSPLKTA
FT                   VNDSRVEFIALDFSNPPEKLADQMRSQCADVTHAYFSSYVHKDDFAELNEANRSLFENF
FT                   LNALVDVAKGLQNCTLQTGGKYYNVHVRPVPWPAHEGHPRLVRAEENFYYHQEDFLAEK
FT                   QRGSNWTWNVIRPEAIIGYTTKPNGMNEALTIALYFLINKELGVEAPMPTNAAYFNGVD
FT                   DVSDARLIADLTIYASTHKNCANEAFNVTNGDVFSWRYMWPRLADWFGAKASSNQSFNR
FT                   TSFKEGETHLDLNLEQWAQDKREVWNRLCDKAGSPLSKASFDAGTWTFQDWVFQRTWSS
FT                   PLSINKARKFGWTGHLDSFDSFVDAFKRFKELGQIP"
     atggctaaaa ccgctctcat cacgggcgcc aatggcatca ctggttctgc aattctggaa        60
     tacctcgtca agaatacaac cgcctcagaa tgggagcgta tcatcatcac gtctcggtcg       120
     cccctgaaga cggccgtcaa cgattctcgc gtggaattca tcgctctcga cttttccaat       180
     ccgcctgaga agctcgcgga ccagatgcgc tcccaatgtg ctgatgtgac ccacgcatac       240
     ttttcatcct acgttcacaa ggacgacttt gccgagctaa acgaagccaa tcgctccctg       300
     tttgagaatt ttctcaatgc cttggtcgat gtggcaaaag gccttcagaa ctgtacactc       360
     cagactggag gaaagtacta caatgtccac gtccgaccgg ttccatggcc agctcacgaa       420
     ggccaccctc gtcttgttcg cgccgaggaa aacttctact atcatcagga agatttcttg       480
     gctgagaaac agcgcggttc gaattggacc tggaatgtaa tccgcccaga ggcaatcatc       540
     ggctacacca cgaagcccaa tggcatgaat gaggccctta ccattgcact ctacttcttg       600
     atcaacaagg agctgggcgt ggaggcccct atgcccacca acgctgccta tttcaacggg       660
     gtggatgatg tatctgatgc acgtctcatt gccgacttga ccatttacgc ctcaacccac       720
     aaaaactgtg caaacgaagc cttcaacgtc acaaatggtg atgtcttcag ctggcggtac       780
     atgtggcccc ggttggcaga ctggtttgga gccaaggctt cgtccaacca gtccttcaac       840
     cgtacatctt tcaaggaggg tgaaacccat cttgatttga acctcgaaca gtgggcgcaa       900
     gacaagaggg aggtctggaa caggctttgc gataaggcgg gttctcccct aagcaaagca       960
     agctttgatg caggcacttg gacttttcaa gattgggtct tccagcggac ttggagttca      1020
     cccttgagca tcaacaaggc acgcaagttt ggctggactg gccacctgga ctcatttgat      1080
     tcctttgtgg acgctttcaa aagattcaag gaacttggac agattccctg a               1131
//

If you have problems or comments...

PBIL Back to PBIL home page