(data stored in ACNUC16935 zone)

EMBL: BN001307.PE340

BN001307.PE340       Location/Qualifiers
FT   CDS_pept        complement(join(930716..932166,932216..932657))
FT                   /locus_tag="ANIA_01500"
FT                   /old_locus_tag="AN1500.4"
FT                   /product="C2H2 finger domain protein, putative
FT                   (AFU_orthologue; AFUA_8G05010)"
FT                   /note="transcript_id=CADANIAT00008125"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008125"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008125"
FT                   /db_xref="GOA:Q5BD80"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD80"
FT                   /protein_id="CBF84993.1"
FT                   /translation="MMALEPSRQHQGPYFQDYSIDPALVDSFSFVDSLGAYGPDLTQPS
FT                   FQNTGFGDSYTDMGKQNFPVTTSEGFLSGVSTASGPSIASASSSAMGSPYSANTQTFQE
FT                   DWVDTTHGLSHPTAVMGDLFSNESMVNTFDAEGFYQKKSDSFVDPSLIQPMQQPQLTLT
FT                   PPAISYPEQPDYNLAPTSFYPQSPEPSRFHYAENYMPKQSFPQQSNLAPPSPIPSGPHS
FT                   RPASIYDRRSSISSIHSRPSQASPAPSGAEFEGDVKEKGRCPHPDCGRVFKDLKAHMLT
FT                   HQSERPEKCPIVTCEYHIKGFARKYDKNRHTLTHYKGTMVCGFCPGSGSPAEKSFNRAD
FT                   VFKRHLTSVHGVEQTPPNCRKKSPAASSAKSVSDYCQDATGKCSTCSGTFSNAQDFYEH
FT                   LDDCVLRVVQQEEPSEAINQQRLAEVESDEEVQKTMEKHRLLDTAGSVDQYDDENDDDD
FT                   DDDSDDRRPAKSAKTGKNSRVILGANNAISKSCSNNNSKNRLTASKRRNNRDHYPQSWG
FT                   CPSRNIKMKKRVLCVFDGQRRLWKDEMMLDNEFEVRLKLPGGAGDGTNREAYITDLDVE
FT                   TLKRANGILGATEEERGAWTEGTGGQLIGQPAMLLPDFSQNQEGDVVDIDELMA"
     atgatggcac tagagccttc aaggcaacat caggggccat acttccagga ctactccatt        60
     gatcctgccc tggtcgactc cttcagtttc gtggacagcc ttggtgcata tggtcccgac       120
     ttgacccagc cttcctttca gaatactggg ttcggtgatt catatactga catgggcaaa       180
     caaaattttc ccgttaccac ttcagagggg tttctgtctg gtgtgtcgac cgcttccggt       240
     ccttcgattg ccagcgcttc ttcatcagcc atgggctcgc cttactcggc aaatacgcaa       300
     acctttcaag aggattgggt tgacacaacc cacggtttga gccatcctac tgcagtcatg       360
     ggagatttgt tttccaacga gagtatggta aacacttttg acgcggaggg gttttaccaa       420
     aagaaatcag atagctttgt tgacccctct cttatccagc ccatgcagca accgcaactc       480
     actcttactc ctcccgccat ttcataccct gaacagcccg actacaacct ggccccaacc       540
     agcttctacc ctcagtctcc ggaaccttct cgatttcact atgcagaaaa ttacatgccg       600
     aagcaatcat tcccgcaaca atccaacctc gcccctccct cgccaatacc ctcaggccct       660
     cactctcgcc ctgcgtctat atatgatcgc cggtcgtcga tatcatccat acactctcgt       720
     ccttcacaag caagcccagc tcccagcggt gctgaattcg aaggcgatgt caaggagaag       780
     ggacgttgcc ctcatcccga ctgcgggcgt gtttttaaag acttgaaggc ccacatgctc       840
     acccatcaat cggaacgacc cgaaaagtgt ccgattgtga cctgcgagta ccacatcaag       900
     ggctttgccc gtaaatatga caagaacaga cacactctca cccactacaa gggcacgatg       960
     gtctgcggct tctgtcccgg ctccggctct cccgcggaga agagtttcaa cagggccgac      1020
     gtgttcaagc gccatctaac ctcagttcat ggtgtggagc agaccccacc aaactgccgc      1080
     aagaagagcc cggctgcctc ttctgctaag agcgtctcgg actactgcca agatgcgacg      1140
     ggcaagtgct ccacttgctc aggcaccttc agcaacgcac aggacttcta cgagcatctc      1200
     gacgactgtg tcctccgcgt tgtgcagcaa gaggaaccca gcgaggcgat caaccaacaa      1260
     agacttgcag aagtcgagtc ggatgaggaa gtccagaaga caatggaaaa gcacaggcta      1320
     ctcgacacgg ctggctccgt tgatcaatac gacgatgaaa acgatgacga cgacgatgat      1380
     gactctgacg atcgacgacc agccaagtct gccaaaaccg gcaaaaattc ccgcgtgatt      1440
     ctgggcgcca acaacgccat tagcaagtct tgctcaaaca acaatagtaa aaaccgtctc      1500
     accgcgtcca aacgacgcaa caaccgcgac cactacccac agtcctgggg ctgccccagc      1560
     cgcaatatca agatgaagaa gcgtgtcctc tgcgtcttcg acggccagcg ccgcctttgg      1620
     aaggacgaaa tgatgctcga caatgagttc gaggtccggc taaagctccc cggtggtgct      1680
     ggagacggca caaaccgcga agcttatatc accgacctgg atgtcgagac gcttaagcgc      1740
     gccaacggga tcctcggtgc tactgaggag gaacgtggcg cttggactga aggaactgga      1800
     gggcagctca ttggacagcc agcgatgcta ctccctgact tctcccagaa ccaggagggg      1860
     gatgtcgtgg atattgacga gttgatggct tga                                   1893
//

If you have problems or comments...

PBIL Back to PBIL home page