(data stored in ACNUC16935 zone)

EMBL: BN001307.PE341

BN001307.PE341       Location/Qualifiers
FT   CDS_pept        complement(join(937408..937530,937939..938094,
FT                   938375..938600,938687..938818,939204..939328))
FT                   /locus_tag="ANIA_01501"
FT                   /old_locus_tag="AN1501.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008126"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008126"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008126"
FT                   /db_xref="GOA:Q5BD79"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD79"
FT                   /protein_id="CBF84995.1"
FT                   /translation="MSSVACSWSRLSTEPLALLLPPIALLCSIVHPDSSLELLTRSRDL
FT                   DSAIVAVQDRLTRVIASTIFARDKDPYSVPIASIHGSFIRGEASPEFQAWALPVTHQEF
FT                   ASSSSLSIGEPPDPPLQCHEAPTELNPEYYHVAHSRPESPLAADKPWDSIPLALNALID
FT                   TNWGITAESKESALDRRVACQRTALNRLLRGQGMDGYAADELSWSCGENKRYRNSQSRR
FT                   MMIAVQPDCEKPQTVGSYFVLLVRILHIIRQ"
     atgtcgagtg tcgcctgctc atggagccgg ctctccacag agcctctagc tctgctgctg        60
     ccccctatcg cccttctgtg ctccattgtc catcctgact cgagtttgga gcttttgaca       120
     cgcagccgag atctggacag cgcgatagtg gcagtgcagg atagattgac tagggtgatt       180
     gcgagtacca tatttgcaag agacaaggac ccgtactccg tacctattgc atcgatccat       240
     ggcagtttca tcagagggga agcctccccg gagttccagg cttgggcctt accagttacc       300
     catcaagaat tcgcgtcgag ttccagctta tctattggag aaccgcccga cccacccctg       360
     cagtgccacg aggcccctac ggagttgaac cctgaatact accacgttgc ccacagtcgc       420
     ccggagtcgc cgctggcggc cgacaaacca tgggactcca taccactcgc tctgaatgct       480
     ttgatcgaca cgaactgggg aatcacagca gagtccaagg aatcggcgtt ggaccggcgc       540
     gtggcttgcc aacgaactgc tttgaataga ttacttaggg gccagggtat ggatggatac       600
     gcagcggatg aattaagttg gtcttgtggg gaaaataagc gttatcgaaa cagtcaaagc       660
     cgtcgcatga tgatcgcggt ccaaccagat tgtgagaaac cccagactgt tggcagctat       720
     tttgtcctgt tggttcgcat tttgcacatc attcgacagt aa                          762
//

If you have problems or comments...

PBIL Back to PBIL home page