(data stored in ACNUC16935 zone)

EMBL: BN001307.PE342

BN001307.PE342       Location/Qualifiers
FT   CDS_pept        complement(943464..945275)
FT                   /locus_tag="ANIA_01502"
FT                   /old_locus_tag="AN1502.4"
FT                   /product="N-acetylglucosaminidasePutative uncharacterized
FT                   protein ; [Source:UniProtKB/TrEMBL;Acc:Q9HGI3]"
FT                   /note="transcript_id=CADANIAT00008127"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008127"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008127"
FT                   /db_xref="GOA:G5EB27"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025705"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="InterPro:IPR029019"
FT                   /db_xref="UniProtKB/TrEMBL:G5EB27"
FT                   /protein_id="CBF84996.1"
FT                   /translation="MAYFRLYAVLLAVASSVAAVKVNPLPAPRHISWGHSGPKPLSDVS
FT                   LRTERDTDDSILTNAWNRAWETIVSLEWVPAGIEAPIPEFDEFPTSTPSASAAATRSKR
FT                   ANVPIQFVDVDVEDWDADLQHGVDESYTLDAKAGSDAIDITAKTVWGALHAFTTLQQLV
FT                   ISDGNGGLILEQPVHIKDAPLYPYRGLMVDTGRNFISVRKLHEQLDGMALSKLNVLHWH
FT                   LDDTQSWPVHIDAYPEMTKDAYSARETYSHDDLRNVVAYARARGIRVIPEIDMPAHSAS
FT                   GWQQVDPDIVACANSWWSNDNWPLHTAVQPNPGQLDIINPKTYEVVQDVYEELSSIFTD
FT                   DWFHVGGDEIQPNCYNFSTYVTEWFQEDPSRTYNDLMQHWVDKAVPIFRSVSDSRRLVM
FT                   WEDVVLNTEHADDVPTDIVMQSWNNGLENINKLTERGYDVIVSSADFMYLDCGRGGYVT
FT                   NDDRYNEQTNPDPDTPSFNYGGIGGSWCGPYKTWQRIYNYDFTLNLTNAQAKHVIGATA
FT                   PLWSEQVDDVNISNLFWPRAAALAELVWSGNRDAKGNKRTTLFTQRILNFREYLLANGV
FT                   MAATVVPKYCLQHPHACDLNYDQTVLH"
     atggcctact tccgcctcta cgccgtgttg cttgccgtgg cgtcctcggt cgccgccgtc        60
     aaggtcaatc ctctaccagc tccacgccac atttcctggg gtcattcagg cccaaaaccg       120
     ctatcggatg tcagtttgcg cactgaacga gatactgacg atagtatcct tacgaatgcg       180
     tggaatcgcg cttgggaaac tattgtttct ctagaatggg tccctgccgg aattgaagca       240
     cccattccag aattcgatga gttcccaact tcaaccccat ctgccagtgc cgctgctact       300
     agaagcaagc gcgccaatgt gcctattcag ttcgtcgatg ttgatgtgga agattgggac       360
     gccgatctac agcacggggt ggacgaatct tacactctag acgccaaggc tggttcggac       420
     gcgattgata tcactgcgaa gacggtctgg ggcgcccttc acgctttcac tacgctccaa       480
     caattggtca tctcagacgg aaacgggggt ctgattcttg agcagcccgt ccacatcaaa       540
     gatgcgcctc tctacccata tcgcggactt atggttgata ctgggaggaa cttcatctct       600
     gtccgcaagc tacacgagca gctcgatggc atggcactgt cgaagctcaa tgtccttcac       660
     tggcatctgg acgataccca atcatggccg gtgcacattg atgcttaccc ggagatgacc       720
     aaggacgcat actccgcgcg cgagacttac tcccatgatg acctgcgcaa tgttgtggcg       780
     tacgcgcgcg cccgtggaat ccgtgtgatc ccggaaattg atatgcccgc ccactctgcc       840
     tctggttggc aacaggttga ccccgatatt gtagcctgcg ccaattcctg gtggtccaac       900
     gacaactggc cgttgcatac tgcagtccag ccgaacccag gacagctcga tatcatcaat       960
     cccaagacgt acgaagtcgt tcaagacgtg tacgaagagc tatcaagcat cttcaccgat      1020
     gactggttcc atgttggtgg cgacgagatt cagcccaact gctacaactt cagcacctac      1080
     gtgactgaat ggttccaaga ggacccctcg cgcacttaca acgacctcat gcagcactgg      1140
     gtcgacaagg ccgtgcctat cttccgcagc gtcagcgact cccgccgcct agttatgtgg      1200
     gaagacgtcg tcctcaatac cgagcatgct gacgacgtcc cgacagacat cgtcatgcaa      1260
     agctggaaca acggcctcga aaacatcaac aagctcaccg aacgcggcta tgatgtgatc      1320
     gtctcctccg cggacttcat gtacctcgac tgcggccgcg gaggctacgt caccaacgac      1380
     gacagataca acgagcagac caacccagac cctgacaccc cgagtttcaa ctatggcggc      1440
     attggcggct cctggtgcgg cccgtacaag acatggcaac gcatctacaa ctacgatttt      1500
     accctcaacc tcacaaatgc ccaagcaaag cacgtcatcg gcgcaacagc accgctctgg      1560
     tccgagcagg ttgacgatgt caacatctcc aacctgtttt ggcctcgggc tgcagctctc      1620
     gctgaactcg tgtggtcagg caaccgcgat gcaaagggga acaaacgcac cactctcttc      1680
     acccaacgaa tcctcaactt ccgcgagtat cttcttgcca acggcgttat ggctgctact      1740
     gtcgttccga agtattgcct gcagcacccg catgcttgtg atttaaatta tgaccagaca      1800
     gtccttcact ag                                                          1812
//

If you have problems or comments...

PBIL Back to PBIL home page