(data stored in ACNUC16935 zone)

EMBL: BN001307.PE343

BN001307.PE343       Location/Qualifiers
FT   CDS_pept        complement(946750..947679)
FT                   /locus_tag="ANIA_01503"
FT                   /old_locus_tag="AN1503.4"
FT                   /product="Dihydrodipicolinate synthase-like protein AN1503
FT                   (DHDPS-like protein)(EC 4.-.-.-)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5BD77]"
FT                   /note="transcript_id=CADANIAT00008128"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008128"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008128"
FT                   /db_xref="GOA:Q5BD77"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5BD77"
FT                   /protein_id="CBF84998.1"
FT                   /translation="MANRPLVPGVYVPTVAFFAENEDVDVATVEKHAAYLAKSGVAGIV
FT                   VQGSNGEAVHLDREERNLITSATRHALDSVGATSMPVIVGTGAPSTRETINLCKDAAAA
FT                   GGDYVLVLPPSYYKSLVSSAALLDHFRAVADASPIPVLIYNFPGASAGLDLSSDDILAL
FT                   SSHPNIIGTKLTCGNTGKLTRIVAQAGPSFLTFGGSCDFTLQTLIGGGAGVIAGTANII
FT                   PRACVRIMELYRAGRVEEAQKVQAIVARADWLAIKGGFVAVKSALQSYRGYGQQPRRPC
FT                   VAPSSEEAAALKEAFSESIELERQLESQ"
     atggccaatc gtccgctcgt cccgggcgtc tacgtcccta ccgttgcgtt cttcgctgag        60
     aacgaagatg tcgatgttgc cactgtggag aaacatgccg cctacctcgc aaagtccggg       120
     gttgccggca ttgttgtgca aggaagtaac ggcgaggccg ttcaccttga ccgtgaagag       180
     cgcaatctca ttacctctgc gactcggcat gctctcgact ctgtcggcgc cacctccatg       240
     cccgtaatcg tgggcaccgg tgccccctcc actcgcgaaa ccatcaacct ctgcaaagac       300
     gccgcggccg ccggcggtga ctatgtcctc gtcctcccgc cgagctatta caagagtctt       360
     gtgtcatccg ctgccttact cgaccacttc cgcgccgtcg cagacgcttc tccgatcccc       420
     gtcctcatct acaatttccc cggcgcgtct gcggggctcg acctctcttc cgacgacatc       480
     ctcgcgcttt cttctcaccc taatatcatc ggcacaaagc tcacctgcgg caatacgggc       540
     aagctgaccc gtatcgttgc gcaggctgga ccctcgttcc tcaccttcgg gggctcgtgc       600
     gatttcactc ttcagactct tatcgggggc ggcgcagggg ttattgccgg tactgccaat       660
     atcatccctc gtgcctgtgt ccggatcatg gaactctacc gtgccggccg tgtcgaagag       720
     gcgcaaaaag tgcaggctat agtggcccgt gcggactggc tcgcaattaa gggcgggttt       780
     gtggctgtta agagtgcact gcaatcctat cgcggatatg gacagcagcc gcggcggccg       840
     tgcgttgcgc cttcatcgga ggaagcagcg gcattgaagg aagctttcag cgagagtatc       900
     gagctggaga ggcagctgga atcgcaataa                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page