(data stored in ACNUC16935 zone)

EMBL: BN001307.PE344

BN001307.PE344       Location/Qualifiers
FT   CDS_pept        join(949403..950049,950211..951103,951164..952134)
FT                   /locus_tag="ANIA_01504"
FT                   /old_locus_tag="AN1504.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008129"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008129"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008129"
FT                   /db_xref="GOA:C8VMN5"
FT                   /db_xref="InterPro:IPR029184"
FT                   /db_xref="InterPro:IPR038988"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMN5"
FT                   /protein_id="CBF85000.1"
FT                   /translation="MRKALVITATAISGLSLAVSLYLSHQKRYLASQVRHSSERGQLSP
FT                   STPRNVSSISSDIFSSEYYTLYDYASISAPRHSLPDLEPSQLLIALLRRNMSSFASSPQ
FT                   ARLLKLAASDPETIRSFDRAHIVALDFDEGDLVCNAYRVRLRAPEKVEFEFLFGVQGRL
FT                   VVSVEVKGEDMVFHNETLMWRDKDTKNKLPLENGFANWVHELTAWWMLESGISFELTRS
FT                   GHSCHSSRIQFPLPRVISHRHRALMRPERVEEIPSRFPPLPTDPMTSTAIMPARSRSSL
FT                   RALRRDPNATNDDSAGVQPPPPKRPRLNLFPSRRRKSSPDLLDTTIDSSPSTSSTKLRR
FT                   PRPLLAHSAHTTSSPPSGSSTPHARNLRQHHTPNSSSAALYLNGGRESPDPLDTISPAP
FT                   ALKPSTITTSTPTPTSAAYRQRRLTQYLKPASEQAVKDSSKSKNTRPARGSTVPPPSDE
FT                   SAPQSLTVPSETADRAVPEKRRSLRSHDGGSRAKSELALYFPNYDQIMSLEPPKTELLS
FT                   ENTVIKLIDDLAEPLDLSSAPSSSDADAPFGNPLVNLYKCDVITLPDTQLKNESRPDIE
FT                   AGEAEEDDPLNDEFYFKAHRRHERQEKQLRNIERDRARHDQQQLDRLLDELQGHDWLRV
FT                   MGITGRSLSEQDKKLYEPKRDYFIAEISTLLQKFKIWKEEEKRRKLDKDYKSASFHSDA
FT                   AEPSYGNAKDNDRKDDDEEATAEPTSDDVDALAARQLLQEARSATAGKQPKSKLEQQEL
FT                   AQSAPPPLPGLPKPFTSFFAKPHLRAQAMSGNRKGRTRLAFGHLIPELGERDFELPGDI
FT                   LTPEAIKDCQRKRRRMKRDKASSG"
     atgagaaaag ccctcgtcat cacggcaacg gccatcagtg gcctctcact agccgtctcc        60
     ctataccttt cacaccagaa acgctatctc gcatcacagg tcagacattc ttcagaacgc       120
     ggccagctct ctccttcaac accgcgcaat gtctcctcca tctcgtccga tatcttcagc       180
     tcagagtact atacccttta tgactacgcc tccatctcag cgccacgcca ctccctacca       240
     gacctcgaac caagccaact cctcatcgcg cttctccgcc gaaatatgtc ctctttcgca       300
     tcttcgccac aagcccgcct tctcaaactc gcagcatcag acccggaaac catccggagc       360
     ttcgaccgcg cgcacatagt ggctctcgac tttgacgagg gggatctggt ctgtaatgcg       420
     tatagggtta ggctacgtgc gcccgagaag gtagagtttg aattcctgtt tggggttcag       480
     ggccggttgg tggtgagtgt tgaagttaaa ggggaggaca tggtctttca caacgaaacg       540
     ctcatgtgga gggacaagga tacaaagaat aagctccctc tagagaatgg gttcgcgaat       600
     tgggtgcacg aattgactgc ttggtggatg ctggagtcgg gaataagctt cgagttgacc       660
     agatccggtc attcttgcca ttcctctcgt atccaattcc cccttccacg cgtcatctca       720
     caccggcatc gggctttgat gcgcccagag cgcgtcgaag aaatccccag tcgctttccc       780
     ccattaccta cagatccaat gacctccaca gccatcatgc ccgcgcgatc gaggtcatct       840
     ctccgcgccc tgcgcagaga ccccaacgcc acgaacgatg attccgcggg cgttcaaccg       900
     cctcccccca agcgaccccg tctgaacctt ttcccctcgc gtcgtcgaaa gagctctcca       960
     gatctcctcg ataccacaat cgacagctcg ccctccacct cctccacaaa gctccgccga      1020
     ccgcgaccgc tcctcgcgca ttccgctcac accacttcct ctccgccatc cggtagcagc      1080
     acgcctcacg cccgaaacct ccgtcaacac cacactccta attcgagttc agcggcacta      1140
     tatctgaatg gtggccgcga gtccccggat ccccttgata caatctcgcc tgctccggct      1200
     ctgaaaccat ctacaatcac tactagtacg cccacgccca cctccgcggc gtatcgccag      1260
     cgtcgtctca cgcagtacct aaaacccgcg tctgaacaag ctgtaaagga tagttcaaag      1320
     tcaaagaata cccgtccggc tcggggctcg accgtcccgc caccttcaga cgaatcagct      1380
     ccccaatcgt tgacagtacc ttccgaaacg gccgatcgcg ctgtgccaga gaagcggcgg      1440
     agccttcgct cccatgatgg gggttcaagg gcgaagagcg aattggcgct ctattttcca      1500
     aattatgatc agataatgag tttggagcct ccaaaaacag aattgctgtc agagaataca      1560
     gttataaagc taatagatga tcttgccgaa cctctcgatt tatcctccgc cccttcgagt      1620
     tctgatgcgg acgcgccctt cggaaacccc ctggtcaatc tatacaagtg cgacgttata      1680
     accttgcctg atacccagct caaaaatgag tcaaggcctg atattgaagc tggagaggct      1740
     gaggaagacg accccctaaa cgacgaattc tacttcaaag ctcatagacg acacgaacgg      1800
     caagagaagc aactccgaaa catcgagcgt gaccgcgcac ggcatgatca acaacaacta      1860
     gaccgactcc tcgacgagct ccaaggtcac gactggctgc gtgtgatggg catcacaggc      1920
     cgcagtcttt cagagcaaga caagaaactt tacgagccga aacgcgacta cttcatcgca      1980
     gaaatctcga ccttactcca aaagttcaag atctggaagg aagaagaaaa gcgccgtaag      2040
     cttgataaag attacaagtc tgcgtcgttc cactccgacg ccgccgaacc atcctacggc      2100
     aatgcaaaag ataacgacag aaaggacgac gacgaggaag ccaccgctga accaacatcc      2160
     gatgacgttg acgccctagc agcccgtcaa ctccttcagg aagcccgctc tgcaacagcc      2220
     gggaaacaac caaagtcgaa attagagcag caagaacttg cgcaatctgc tccaccacct      2280
     cttcctggtc tgcccaaacc attcacctcg ttcttcgcga aaccgcatct ccgcgcacag      2340
     gctatgtcgg gaaaccgcaa ggggcgaacg aggcttgcat tcggacatct gattccggag      2400
     cttggagaga gggactttga gcttcctggg gatattttga cgcctgaggc aatcaaggac      2460
     tgtcagagga agaggaggag aatgaagagg gataaggcga gttccggata a               2511
//

If you have problems or comments...

PBIL Back to PBIL home page