(data stored in ACNUC16935 zone)

EMBL: BN001307.PE345

BN001307.PE345       Location/Qualifiers
FT   CDS_pept        complement(join(952617..953042,953098..953312,
FT                   953368..953511,953565..953896,953978..954064,
FT                   954134..954342))
FT                   /locus_tag="ANIA_01505"
FT                   /old_locus_tag="AN1505.4"
FT                   /product="amino acid transporter (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008130"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008130"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008130"
FT                   /db_xref="GOA:Q5BD75"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD75"
FT                   /protein_id="CBF85002.1"
FT                   /translation="MAQNAESSVPYGHEESGPEKNVTTDEDSFTRDDVKKTENSPPPYT
FT                   QSPFTSDAFGDEEFAEVKYKTLKWWQCGLLMVAETVSLGVLSLPAAVAGLGFVPAIIIL
FT                   VALGLFATYTGYVIGQFKNRFPHVTNMADAGEVVAGKWGREFMGVAQMLFFVFVMASHL
FT                   LTFTVAMNTLTEHGTCSIVFGVVGMIVSFILCLPRTLEKMSWLSLVSFISIFSAVMICM
FT                   VGVGISKPGVNNTAAVVDTDLYHGFTAVTNIVFAFCGHAAFFGLAAELKDPRDFPKGLC
FT                   LLQGIDISLYLIAAVVIYRYGGADVTSPALGSASPIVSKVAYGIALPTILIAGVIYGHV
FT                   AAKYIYIRIFRGTDRMHKRDAVAIGSWVVIALCLWILAWIIAEAIPVFSNLLSLITALF
FT                   ASWFTYGLSGIFWLFMNKGLWFKNWKKISLTMVNLLAIGVACVLCGMGLWVSGKALHDN
FT                   PSSASFSCANNA"
     atggctcaaa acgctgagtc gtcggtccca tatggacacg aagaatcagg cccagagaag        60
     aacgtgacta ccgacgagga ttctttcacc agagatgacg tgaagaagac ggagaactcg       120
     ccccctccat acacgcaatc gccgttcaca tcagatgcct ttggcgatga ggagtttgcc       180
     gaagtcaaat acaagacttt gaagtggtgg caatgcggtc tgcttatggt ggccgaaaca       240
     gtgtcccttg gtgttctgtc gctgcctgcc gctgttgcag gtttgggttt tgtcccagcc       300
     atcattattc tcgttgcgct gggtcttttt gcgacatata cgggttacgt cattggacag       360
     ttcaagaatc ggtttccgca cgttacgaac atggcagacg ccggtgaggt cgtggcaggg       420
     aaatggggtc gcgagttcat gggcgttgcg cagatgctgt tcttcgtctt cgtcatggcg       480
     agccatttgc tgacgttcac tgtcgctatg aataccctca ctgagcacgg cacgtgctca       540
     attgtctttg gcgttgtggg catgatcgtc tcgttcatcc tgtgcttgcc tcgcactctg       600
     gagaagatgt cctggctctc gctagtctcg ttcatcagta tcttctcggc cgtcatgatc       660
     tgcatggttg gcgtcggtat cagcaagcca ggggtaaaca atactgcagc tgtcgtcgac       720
     acggacctct accacggctt cactgccgtg actaacattg tctttgcttt ttgtggacac       780
     gctgcttttt tcggtctcgc tgctgaactc aaagatcccc gcgacttccc caagggcctc       840
     tgcctccttc aaggaattga catctctctc tacctcatcg cggccgtcgt gatctaccgc       900
     tacggtggcg cagacgttac ctcgcccgct ctgggatccg caagtccaat cgtcagcaaa       960
     gttgcctatg gcattgccct ccctaccatc ctcattgcag gtgtcattta cggccatgtt      1020
     gccgccaaat acatctatat ccgcatcttc cgcggcacag accgcatgca caagcgcgac      1080
     gccgtcgcca tcggctcgtg ggttgtcatt gctctttgcc tctggattct agcctggatc      1140
     attgccgagg ctatccccgt cttctccaac ctgctcagtc tgatcacagc cctttttgca      1200
     agctggttca cttatggcct ttccggaatc ttctggcttt tcatgaacaa aggtctctgg      1260
     ttcaagaact ggaagaagat ttcgctcaca atggtcaatc tgctggccat cggagttgct      1320
     tgtgtgctct gtggtatggg cctctgggtg tctggcaagg cgttgcatga taacccaagc      1380
     tcagccagct tttcttgcgc gaataatgct tag                                   1413
//

If you have problems or comments...

PBIL Back to PBIL home page