(data stored in ACNUC16935 zone)

EMBL: BN001307.PE347

BN001307.PE347       Location/Qualifiers
FT   CDS_pept        complement(join(957522..958130,958179..958211))
FT                   /locus_tag="ANIA_01507"
FT                   /old_locus_tag="AN1507.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008132"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008132"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008132"
FT                   /db_xref="GOA:Q5BD73"
FT                   /db_xref="InterPro:IPR024526"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD73"
FT                   /protein_id="CBF85006.1"
FT                   /translation="MAHVHIPTVTLEDLQAFQAKHFPATVKPQPLQSTSYPTHDAYNED
FT                   FYANADEEDVDDEDDDLGYYPDGVKRTLTDEQIRIFRHSEIHALLREKQIKQENEEYEK
FT                   GLGGKTEAQPEAGAQVHTSLDERDGAISAPPKDVAKAVAGRKRCADKVGCDAGADEPVL
FT                   KRKPTSDSGAPSEVQLDYNEESAAAPTTASQSRATRATPFMGRRIISYDD"
     atggctcatg ttcatatccc aaccgtaact ttagaagacc tccaagcctt tcaagccaag        60
     cactttcctg ccaccgtcaa accgcaacct ctgcaatcta cctcgtaccc gacccacgat       120
     gcctacaacg aagacttcta cgccaacgct gatgaagaag atgttgatga cgaagatgac       180
     gatctcggct actaccccga cggcgtgaaa cgcacactca cagatgaaca gattcgcatt       240
     ttcagacata gtgagatcca tgcacttttg agagagaagc agataaagca ggaaaacgag       300
     gagtatgaga agggccttgg gggtaaaact gaagcacagc ctgaggccgg agctcaggtg       360
     catactagcc tcgatgagag agatggagca atttctgctc cgccgaagga tgttgccaag       420
     gcagtcgccg gcaggaaacg ctgtgctgat aaggttggat gtgatgcagg cgcagacgaa       480
     ccggttttga agagaaagcc cacatcggac tcgggggccc caagcgaagt gcaactggat       540
     tacaacgagg agagtgctgc tgctccaaca actgcaagtc agtccagggc tacgcgagca       600
     actccgttta tgggccggag aatcatttcg tacgatgatt ga                          642
//

If you have problems or comments...

PBIL Back to PBIL home page