(data stored in ACNUC16935 zone)

EMBL: BN001307.PE348

BN001307.PE348       Location/Qualifiers
FT   CDS_pept        complement(join(958666..959065,959096..959184,
FT                   959232..959344,959395..959647))
FT                   /locus_tag="ANIA_01508"
FT                   /old_locus_tag="AN1508.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008133"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008133"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008133"
FT                   /db_xref="GOA:Q5BD72"
FT                   /db_xref="InterPro:IPR027521"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD72"
FT                   /protein_id="CBF85007.1"
FT                   /translation="MALVQYSDSESDSEKEAPPRKINKPSQNLSHNPASTLPPLPASFH
FT                   DLYASSVKVSVRDDPSLHGGRKRVIPHVEGNWPTHIYLEWYPSKKELEILGNIIRQAEH
FT                   MFRAEQAKLNSFLYSDLGNGGEAAVYGHIWSGTKWLWHLTVCAICPSVFEVQIDSLDWV
FT                   SNFERTRWFYVLRVKRPEGDGLNRLLHISNRSLGLFNQPPLYAPLFNSKSGTQPSIRVS
FT                   KPTSTGDYTECFHISIAWSLEEPSAEEKKSMESIDIQRLKALKIKFDCLKAKIGNNVSS
FT                   IPL"
     atggccttgg tgcaatactc tgactcagaa tctgactcgg agaaagaagc ccctcccaga        60
     aaaatcaata aaccaagtca aaacctgagt cataacccag cctcaacgct accgccgttg       120
     cctgcatcat tccacgatct ttacgcttct agcgtcaaag tcagtgtcag agatgaccca       180
     agccttcacg gtgggcggaa gagggtaatt cctcatgttg agggaaactg gcccactcat       240
     atatatctcg agtggtatcc atcgaagaag gagcttgaga ttctgggcaa cataatccgc       300
     caagcagaac atatgtttcg cgctgaacaa gcgaaactca atagcttctt gtatagtgat       360
     ctaggcaacg gaggagaggc agccgtttat ggacacattt ggagcggcac taagtggctc       420
     tggcatctca ccgtttgtgc catttgtccc tcagtatttg aggtccagat cgacagttta       480
     gactgggtct ccaactttga gagaacacgg tggttttatg tgctccgagt aaaacggcca       540
     gagggagacg gtctgaaccg ccttttgcat atctctaacc gctcgcttgg tctttttaat       600
     caaccgccac tatacgcacc tttatttaac tcgaaatctg gaacccaacc aagtattcga       660
     gtcagcaagc ctacatcaac gggcgattac accgagtgct tccatatctc tattgcgtgg       720
     agcctagaag agccatctgc tgaagagaag aaaagcatgg aaagcataga tattcagcgg       780
     cttaaagctc tcaagatcaa gtttgattgt ttgaaggcga agatcggcaa caatgtctcg       840
     agcataccac tttga                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page