(data stored in ACNUC16935 zone)

EMBL: BN001307.PE349

BN001307.PE349       Location/Qualifiers
FT   CDS_pept        join(962232..962813,962867..962983)
FT                   /locus_tag="ANIA_01509"
FT                   /old_locus_tag="AN1509.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008134"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008134"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008134"
FT                   /db_xref="GOA:Q5BD71"
FT                   /db_xref="InterPro:IPR013226"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD71"
FT                   /protein_id="CBF85009.1"
FT                   /translation="MQQYQMDHAYPMPGSQSPKSISSASLGSGSPYQRFLSPSPSPTRS
FT                   TRRRSRTTSVLPADYAYADILFDASQHNRGRRSRRSGLNARRSQLVKPDVIDRMDTAAQ
FT                   FSYHHEGPYDAVYPERNRISIHSPLDALRESNEEALKATPRHMIADAIGRRRPLDGVAF
FT                   YPPGYTDPEGQTYDYEEGPNLMADCCLFPRQRFTDEDFRNDPFTNTPVKPFAPLRNVFR
FT                   RTPRKHRNTA"
     atgcagcaat atcaaatgga ccacgcctac cccatgcccg gctcccagag cccgaagagc        60
     attagttccg catcgctggg cagcggaagc ccataccaac gctttctttc gccgtcgccg       120
     tcgccaacgc ggtcgaccag acgacgtagc cgcaccactt cagtcctacc tgcagactac       180
     gcctatgccg atatactctt tgacgcttcc cagcacaacc gcggaagacg ttctcggcgc       240
     tctggactga atgcccggcg gtctcagctc gtcaaaccag acgtgatcga tcgcatggac       300
     acagcggccc agttctctta ccatcacgaa ggaccgtacg acgccgtcta cccagagcgc       360
     aacagaatca gtatccactc gccactggat gctctcaggg agtctaacga agaggccctt       420
     aaggcaactc cgcgccacat gatcgccgac gccatcggcc ggcgccggcc tctcgatggg       480
     gtggccttct atcctcctgg ctataccgac ccagagggcc agacgtacga ttatgaagaa       540
     ggtccgaatt taatggctga ctgttgcttg ttcccccgcc agagattcac agacgaggac       600
     ttcaggaatg atccttttac gaacacgccg gtaaaaccct ttgctccact tcgcaacgtc       660
     ttccgacgga ccccgaggaa gcacaggaac acggcgtag                              699
//

If you have problems or comments...

PBIL Back to PBIL home page