(data stored in ACNUC16935 zone)

EMBL: BN001307.PE35

BN001307.PE35        Location/Qualifiers
FT   CDS_pept        join(94636..94668,94719..94733,94792..94842,94901..95279,
FT                   95358..95488,95545..95775)
FT                   /locus_tag="ANIA_09027"
FT                   /old_locus_tag="AN9027.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007826"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007826"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007826"
FT                   /db_xref="GOA:Q5ARQ3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARQ3"
FT                   /protein_id="CBF84434.1"
FT                   /translation="MSSVNIDQAPQGTKLWLLHLGYVEADEGFFLAGAGTSTMTNPNCK
FT                   NPRRKLVLTSALIDHPIEGLILFETGPGEAYPEVWGPPVNDIFGRVDYSPEHELEAALA
FT                   KSGHSIKDIKAVIMGHLHIDHAGGLEKFSGTDIPIYVHEEELKHAFYSVATKSDAGVYH
FT                   GKDLDAKLNWTAIHGETFELAQGITLRHAPGHTPGLVLMQVNLPDSGTWLFTTDQYHVS
FT                   ENYEQSIPHGWLARDYHAWVKTHQMVKTIAKRTNANLVFGHDLGVFFQYEHAPHAYT"
     atgagttctg tgaatattga ccaggctcca cagggcacaa aactgtggtt acttcatctt        60
     ggatatgtgg aagcagacga ggggtttttc ctcgcagggg ccggtacttc gactatgaca       120
     aatcccaact gcaagaaccc acgacgcaag cttgtcctta catcagcact gattgatcat       180
     ccaatcgagg gtctcatcct gtttgagact gggcctgggg aggcataccc cgaagtttgg       240
     ggcccgcctg tcaatgatat atttgggcgg gttgactatt cgccagagca tgaactcgaa       300
     gccgctctcg ccaagtccgg acactcgatc aaggatatca aagctgtgat catggggcat       360
     ctccatatcg accatgccgg ggggcttgag aaattcagcg gaaccgatat tccgatctat       420
     gtacacgaag aagagcttaa gcacgcgttt tacagtgtgg ccaccaagtc cgacgcaggt       480
     gtctatcatg gcaaagatct tgacgccaag ctcaattgga cggccatcca tggggagaca       540
     tttgagcttg cccagggtat taccctgagg catgcacccg gccacactcc agggctggtc       600
     cttatgcagg tcaatcttcc agacagtggg acatggctat ttactaccga ccaataccat       660
     gtcagcgaga attacgaaca atctattccg catggctggc ttgctcgaga ctatcatgcc       720
     tgggtcaaga cgcatcagat ggtgaagacc attgcaaagc gaacaaatgc gaatctggtg       780
     ttcggacacg atttgggagt atttttccag tatgaacatg cccctcatgc ctacacctag       840
//

If you have problems or comments...

PBIL Back to PBIL home page