(data stored in ACNUC16935 zone)

EMBL: BN001307.PE351

BN001307.PE351       Location/Qualifiers
FT   CDS_pept        join(967001..967052,967114..967617,967667..968421)
FT                   /locus_tag="ANIA_01511"
FT                   /old_locus_tag="AN1511.4"
FT                   /product="microbody (peroxisome) biogenesis protein peroxin
FT                   13 (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008136"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008136"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008136"
FT                   /db_xref="GOA:Q5BD69"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR007223"
FT                   /db_xref="InterPro:IPR035463"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD69"
FT                   /protein_id="CBF85013.1"
FT                   /translation="MASVSPPKPWERAGATAGTALSSPATTSTAMSSTSTTSAAPTAGT
FT                   STTSATAPPSLPSRPSTLSTVANQNASNYSPYGASRFGASPYGGYGGYGSYSSPYSRFG
FT                   GMGSMYGGYGGYGGMYSGMGGYGGMYGGGMPGDPNDPNSLTNSFNQSTQATFQMIESIV
FT                   GAFGGFAQMLESTYMATHSSFFAMVSVAEQFGNLRNTLGSALGIFTLIRWFKTLIAKIT
FT                   GRPPPADATALTPAAFAAFMGGRATLPDGSPAPPRPSRKPFLMFLVALFGLPYLMGKLI
FT                   KSLARSQEAQRQKIMMTANGEQQGVLDPSKLDFCRVLYDYTPESQETNGIDLAVKKGDI
FT                   VAVLSKSDPMGNASEWWRCRARDGRVGYLPGPYLETIQRKPQQQALTSGSEAGSRSNTM
FT                   QSQTQVGNEVAAGQKPELKGKMGDISAESFQKSAFYS"
     atggcgtccg tatcgccacc caaaccctgg gagagagccg gcgccactgc aggcactgcg        60
     ttatcatcac cagcgaccac atccacggcc atgtcctcaa cgtccacgac atcggcggcc       120
     ccgaccgcag ggacctccac aacaagcgca acggcacccc cttctctacc ctcccgacct       180
     agcacactta gtactgttgc gaaccaaaac gcctcaaact actccccata tggcgcctca       240
     cgatttggtg cgtcgccata tggcggctat ggcggctatg gaagctactc atccccgtat       300
     tcgcgattcg gtggaatggg ctcaatgtac ggcggttatg gcggctatgg tgggatgtac       360
     agcggtatgg gagggtacgg aggcatgtac ggcggtggca tgcctggcga cccaaatgac       420
     ccgaacagtt tgacgaactc attcaaccag agtactcagg caacgtttca gatgatcgag       480
     agtattgtcg gggctttcgg tggcttcgcg cagatgcttg agagcactta tatggcgacg       540
     catagttcgt tttttgccat ggtatccgtc gctgagcagt tcggaaacct gcgtaacacg       600
     cttggctctg ccttgggcat cttcacatta atccggtggt tcaagacgtt gatcgcgaaa       660
     ataactggtc gtccaccgcc agcagacgct acggccctta caccagctgc attcgctgca       720
     tttatgggcg gccgggccac actcccagat ggctctccag cgcctccacg gccttcacgg       780
     aagccattcc tgatgttcct tgttgccctc tttggacttc cgtacttaat gggcaaactt       840
     ataaaatctc ttgcacgttc ccaagaagca caacgtcaga aaatcatgat gaccgccaac       900
     ggtgagcagc agggcgtttt ggacccgtcc aagctcgact tctgccgcgt tctctacgat       960
     tatacacccg aatcacagga aaccaacggc attgatctgg ccgtgaagaa gggcgacatt      1020
     gtcgctgtgc tcagcaaatc cgatccgatg ggcaatgcgt cggaatggtg gcgttgccgc      1080
     gcgcgagacg gccgcgtagg ataccttccg ggtccgtatc tcgagactat ccaacgcaag      1140
     ccacagcagc aggcccttac ctccggcagt gaagcgggca gtcgcagtaa cacgatgcag      1200
     agccagacgc aggtcggcaa tgaggttgcc gcgggtcaga agccagagct taaggggaaa      1260
     atgggtgata tttctgcgga gagtttccaa aagagcgcgt tctattcatg a               1311
//

If you have problems or comments...

PBIL Back to PBIL home page