(data stored in ACNUC16935 zone)

EMBL: BN001307.PE353

BN001307.PE353       Location/Qualifiers
FT   CDS_pept        complement(join(971084..971293,971343..972313,
FT                   972381..972696))
FT                   /locus_tag="ANIA_10212"
FT                   /old_locus_tag="AN10212.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008138"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008138"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008138"
FT                   /db_xref="GOA:C8VMP4"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMP4"
FT                   /protein_id="CBF85017.1"
FT                   /translation="MDSPVLNQLFRQLFRHPACQSVRPSPSSHTFRLSRSQQQCRPFLT
FT                   RRSAAKRKSTDDGLNWTKRGDYPKNIDEELKTYPLMAAKDLRHRQDRPRQVQMLTREFI
FT                   DDSLYNPHYGYFSKHATIFSPGEPFDFNNIEDGPAFHRLLGERYTEFEDMLDEKQPDEA
FT                   RQLWHTPTELFRPYYGETIARYLVSNYKLTLYPYHDLIIYEMGAGNGTMMINILDFIRD
FT                   TDYEVYQRTKFRIIEISPALAGLQMKNLTDSLYAAGHLDHVEIINKSIFEWDTYVHSPC
FT                   FFLALEVFDNFAHDAIRYDTKTEMPQQGGVLIDGDGEFHEFWTPKLDPLASRFLRVRQA
FT                   AARREFPSPLGPRLARQIRGTLPFQKPYTMPEYIPTRLMQFFDILDNYFPGHRLLASDF
FT                   SSLPDAIPGINAPVVQTRYKRRTVPVSTPFVHQGYFDIFFPTDFNVVEDIYRAITGKLT
FT                   QVASHEDFVRRWAYVEDTETRSGENPLLTWYKNASMLMTV"
     atggactctc cagtccttaa tcagctgttt cgacagctct tccgtcaccc agcctgtcaa        60
     tccgtccgcc cttcgccctc atcccacacg tttcgcctat cgcgatctca acaacagtgc       120
     cgaccgttcc ttacgcgtag gtcggcggcc aagcgcaaga gtaccgacga tggcttgaat       180
     tggacaaaac gaggggatta cccgaagaat atagacgagg aattgaaaac atatccgttg       240
     atggcagcga aagatctgcg ccatcggcag gaccggccac gccaggtaca gatgctaaca       300
     agagaattca ttgacgacag tttatataat ccgcattacg gctacttttc caagcacgcg       360
     accatcttta gccccgggga gccgttcgat ttcaacaata tcgaagatgg gccggccttc       420
     cacaggctgt taggggagcg ctataccgaa tttgaagata tgctagatga aaagcagccg       480
     gatgaggccc gccagttatg gcatacgccg accgagctgt tccggcctta ttatggagag       540
     acaattgccc gctatctcgt gtctaactat aaactgacgc tctatcctta ccatgacctc       600
     atcatatacg aaatgggcgc aggaaacgga acaatgatga ttaacatcct cgacttcatc       660
     cgcgatacag actacgaggt ctatcagcga accaaattcc gcatcattga gatttcgccg       720
     gctctggctg ggcttcaaat gaagaatttg actgactctc tttacgctgc tggtcatttg       780
     gaccacgtcg aaattatcaa caagtctatt tttgaatggg acacctacgt gcactccccg       840
     tgcttcttcc tcgcgcttga agtgtttgac aactttgccc acgacgcaat tcgatatgat       900
     accaagacag aaatgccaca gcagggtgga gtactgattg acggagacgg cgaattccat       960
     gagttctgga cccccaagct ggaccctctt gcatctcgat tcctgcgtgt tcgtcaagcc      1020
     gcagcccggc gtgagttccc cagtccgctg ggaccgcgac tcgcacgaca aatccgcggg      1080
     accttgccat tccaaaaacc ttacacgatg cctgagtata ttcccactcg actgatgcaa      1140
     ttcttcgaca tccttgacaa ctacttccct ggccaccgac tcctagcaag tgacttcagc      1200
     agccttccag atgctattcc gggaatcaat gcgccggtag tacaaacacg atacaagagg      1260
     agaacagttc cagtctccac acctttcgtg catcagggct atttcgatat cttctttccc      1320
     acggatttca atgttgtcga ggacatctac cgagcgatca ctggaaagct aacacaagtg      1380
     gccagccacg aagatttcgt tcgacgctgg gcgtacgtcg aagacacgga aaccaggagt      1440
     ggcgagaacc cgcttctgac gtggtataag aatgctagca tgttgatgac cgtctag         1497
//

If you have problems or comments...

PBIL Back to PBIL home page