(data stored in ACNUC16935 zone)

EMBL: BN001307.PE354

BN001307.PE354       Location/Qualifiers
FT   CDS_pept        join(972915..973202,973260..973319,973366..973484,
FT                   973533..974179,974231..974403)
FT                   /locus_tag="ANIA_01513"
FT                   /old_locus_tag="AN1513.4"
FT                   /product="hypothetical transmembrane protein (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008139"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008139"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008139"
FT                   /db_xref="GOA:Q5BD67"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5BD67"
FT                   /protein_id="CBF85019.1"
FT                   /translation="MPDHSHIYIGSAFVAGVVLTIAFKDLFYPEIEERIRDYRARHSSK
FT                   SYQNASVDSLAVRHGPPAIVDGIEGCIGNTPLLRIKSLSEATGCEILAKAEFLNGAGQS
FT                   SKDRVALSMIELAEERGLMTPHSGDTIYEGTSGSTGISLATLARAKGYLAHICMPSDQA
FT                   IEKSNLLLKLGAIVDRVPPAPIVEKDNFVNRARALAQAHTNSTASESSVGTASQRGRGY
FT                   FADQFENEANWRAHYNGTGPEIYAQCNGSLDAFVAGAGTGGTISGVALYLKPRIPNMTV
FT                   VVADPQGSGLYNRVRYGVMFDTKEKEGTRRRRQVDTIVEGIGINRVTANFEAGRELVDD
FT                   AVRVTDAQALAMARWLVEKDGIFAGSSSAVNCFAAVKTALKLGPGHRIVTMLSDSGSRH
FT                   LSRFWAKAGNVGGAVDTKLEDVLNAKEDQ"
     atgccagatc attcgcatat ctacattggc tctgccttcg tggcaggagt tgtcctgact        60
     atagctttca aggacctatt ctaccccgag atcgaggaac gcatcagaga ttatcgcgct       120
     cggcattcct caaaatcata ccagaacgcc tcagtggatt cgttagctgt gaggcatggg       180
     cctccagcta ttgtagatgg gatcgagggc tgtattggga atacccctct acttcgaatc       240
     aaatccctgt ccgaagcgac cgggtgcgaa atcctagcga aggctgaatt tctgaacggc       300
     gccggtcaga gctcaaagga tcgagtagct ctgagcatga tcgaattggc tgaggagagg       360
     ggattgatga ctccgcattc aggagatacg atctacgaag gaacatctgg gtcgacagga       420
     atctcattgg ccacgctagc tagggcaaag ggctatcttg ctcatatttg tatgccatca       480
     gaccaggcta tcgaaaagtc gaacttactc ctcaaactag gcgcaatagt tgaccgcgtg       540
     cctccagcac ctatagttga gaaggacaac ttcgttaacc gggcaagagc acttgcgcaa       600
     gcacatacca attcgacagc gtcagaatca tcagttggta cagcctccca aaggggaagg       660
     ggttactttg cggaccaatt cgagaacgag gcgaactggc gagcccacta caatggcacc       720
     ggcccggaga tctacgccca gtgcaatggg tcccttgacg cctttgttgc aggggccggg       780
     accggaggca caatctctgg cgtggctcta tatctcaagc cgaggatccc caacatgact       840
     gtggtagtag ccgatcccca aggtagtggg ctctataatc gggttcgtta cggagttatg       900
     ttcgacacta aggagaagga agggacacgt cgtcggaggc aggttgatac tatcgtggaa       960
     ggcattggga tcaaccgcgt taccgcaaat ttcgaggcgg gacgggaact tgttgacgac      1020
     gctgttaggg ttacggacgc gcaggcactg gcaatggcta gatggcttgt tgaaaaggac      1080
     ggcatctttg cggggagtag cagtgctgtc aactgtttcg ccgccgtcaa aactgctttg      1140
     aaactggggc ccggccacag aatcgtcaca atgctgtctg attcaggctc aagacatctc      1200
     tcaaggttct gggcaaaagc tgggaatgtg ggcggcgctg tggacacaaa gttggaggac      1260
     gtcctgaatg cgaaagaaga ccaatag                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page