(data stored in ACNUC16935 zone)

EMBL: BN001307.PE355

BN001307.PE355       Location/Qualifiers
FT   CDS_pept        complement(974629..976368)
FT                   /locus_tag="ANIA_01514"
FT                   /old_locus_tag="AN1514.4"
FT                   /product="Myb-like DNA-binding domain protein
FT                   (AFU_orthologue; AFUA_8G05190)"
FT                   /note="transcript_id=CADANIAT00008140"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008140"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008140"
FT                   /db_xref="GOA:Q5BD66"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR018465"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD66"
FT                   /protein_id="CBF85020.1"
FT                   /translation="MGSPLKRKRLYLWSGADDEYETSDIDLQEARTQNDLRLKSIFEGI
FT                   FEKYGRDFTDVGDEIDLQTGKITVNNGHIDALEVEGNGYGDWLSDARPQAPRHVLAERT
FT                   DYEGKPARLALDADAWGAEDTALEGDHDLQHPGRRTVHLLSHMRPGSRRGLGETTETDS
FT                   DQGAAGDGEDRATSEAEDDRSSVDSLLGTALSIPAQKVGKTTKGETGTEKAIPPHDGSH
FT                   QYQAAHTERLDETVDPIWRVPEISAKFTTPTLPSRPRPNPKPVINNAVRSQSPPGASSV
FT                   WALSGTRKRDTDVVKKIKQKGSPKRRVKHHSSPDAVWDWSFADAPDGSESDDPLQEDYV
FT                   PSPTPKDSVYIREKRKGPFSAGAAQKTCSFCKRIFSRKAYDMHLKDVLANPADNEHDSV
FT                   ELKRQLATVTGDGTTESAPGATNRSPAPAGLIVRITNTPREPDSEAGQRTNHESTPTGS
FT                   KRARTVLGPQEARLIIQMRHIQGMKWKEISDHFPQKKPANIQAWHHVHWKQRKANPPRL
FT                   SGPWSKAELEKLEILKDQPELTWPGIRAEFPGRLLAEIEFKLLQLWAGDNVSQPLRSAS
FT                   PAD"
     atggggtcgc cgctgaaaag aaagcgtctg tatctttggt caggagccga cgacgaatac        60
     gagacgagcg atatcgattt gcaagaagca cgtacccaga acgacttgcg tctgaagtcc       120
     atctttgagg ggattttcga aaagtacggt cgggatttta cagacgtcgg cgacgagatc       180
     gaccttcaga cagggaagat cacggtaaac aacgggcaca tcgatgcact cgaggtggaa       240
     ggcaacggtt atggggactg gctgtcggat gcaaggccgc aggctccgag acatgtacta       300
     gcagaaagga cggattatga gggcaagccg gcgcgccttg cccttgacgc cgatgcgtgg       360
     ggtgcagaag atactgccct ggaaggcgac cacgacctgc aacatcccgg ccggaggacg       420
     gtccatctac tatcacacat gcggccaggc tctaggaggg gattgggcga aactacggaa       480
     acagattcag atcagggtgc ggcgggtgac ggagaggatc gtgctacgtc ggaggctgaa       540
     gacgacaggt cgagtgtgga ttctttgtta ggtaccgcac tatcaatccc ggcccagaaa       600
     gtcggtaaga ccaccaaggg cgagactggc accgaaaaag caattcctcc ccacgacgga       660
     tcccaccaat accaggccgc acatactgag agactcgatg agactgtgga ccccatttgg       720
     cgcgttcctg agatcagtgc gaagtttaca acaccgactt tgccgagtcg acctagacct       780
     aacccaaagc ctgtcattaa caatgcagta cgttcgcagt ctccacccgg tgcgagctcc       840
     gtttgggctc tatccggtac aagaaagcgg gatacggacg tagtgaagaa aataaagcaa       900
     aagggcagcc cgaagaggcg ggtaaaacac cattctagcc ctgatgctgt ctgggactgg       960
     tcatttgctg atgctccaga tggaagcgaa tccgacgatc cattacagga ggactacgta      1020
     ccctcgccca cgccaaagga ctcagtctac attcgggaga agcgcaaagg ccctttctcg      1080
     gcgggcgctg ctcaaaaaac ctgcagcttc tgcaaaagga tcttttctcg caaagcttat      1140
     gacatgcatt tgaaggacgt gctggcgaat cctgcagaca acgaacatga ctcggtagag      1200
     ctcaagagac agctcgccac agtcaccggc gacggtacta ctgagtcggc gcctggtgcc      1260
     actaacagaa gccctgcccc tgctggactc attgttagga ttacaaacac acctagagaa      1320
     ccagactcag aagcaggtca gaggacgaac cacgagtcga cgccgacagg aagcaaacgc      1380
     gctaggacag ttcttggacc gcaggaagcc aggctgatta tccagatgcg acatatccag      1440
     gggatgaagt ggaaggaaat ctcggaccac ttcccacaaa agaaaccagc caacatccaa      1500
     gcatggcacc atgttcactg gaaacaacgc aaggcgaatc ctcctcgact gtccggaccc      1560
     tggtcaaagg ccgaactcga gaaattggaa atactcaagg accaaccaga gctgacatgg      1620
     cctggtatcc gtgctgagtt cccgggccgc ttgcttgcgg agattgaatt taagctgttg      1680
     caactctggg cgggcgataa cgtctcacag cctctgcgtt ctgccagtcc agcagactaa      1740
//

If you have problems or comments...

PBIL Back to PBIL home page