(data stored in ACNUC16935 zone)

EMBL: BN001307.PE356

BN001307.PE356       Location/Qualifiers
FT   CDS_pept        join(976888..976972,977039..978564)
FT                   /locus_tag="ANIA_10213"
FT                   /old_locus_tag="AN10213.4"
FT                   /product="autophagy protein Apg6, putative (AFU_orthologue;
FT                   AFUA_8G05170)"
FT                   /note="transcript_id=CADANIAT00008141"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008141"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008141"
FT                   /db_xref="GOA:C8VMP7"
FT                   /db_xref="InterPro:IPR007243"
FT                   /db_xref="InterPro:IPR038274"
FT                   /db_xref="InterPro:IPR040455"
FT                   /db_xref="InterPro:IPR041691"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMP7"
FT                   /protein_id="CBF85022.1"
FT                   /translation="MYCQKCRTPLKLDGSLEALNPAAFDLLIGSTGKAVPDPSTGSSRL
FT                   SYPQERRDLYDRVSKNASSPVYRRSIPAPRQSGGSSATPSRLGRGDSGNMSFVMLTESQ
FT                   LGPSHTIPGVNGDSASSKGKRASGVQGDDSGADNGSFAEQVERTCRLFEIISARSDIDH
FT                   PICTECTDMLVEGLQQRLAEATKERDAYITFLRNLNSSVPTQEEVETAEKSLKETLEAE
FT                   EAAYAELVALEKENAALDEEIARLEEESRQLDYEEEKFWRDRNAFSLVLADFQNERDAL
FT                   NMKYDHDSRQLERLQRTNVYNDAFCIGHDGYFGTINGLRLGRLANPSVEWPEINAAWGQ
FT                   TALLLATIAEKLNFQFQGYRLRPMGSMSRIDKIEYPRPSPAQSTVEGASNAHQPAAPKI
FT                   TSLDLFSSGDLPLHIPWLHRRFDAGMVAFLECLRQLGEFVEKTPVRSSRRDQAGAVLPG
FT                   LKLPYAIKRDKIGDASIKLGFNQNDETWTRACKYTLTCCKFLLAHASNIASAGSTNSAA
FT                   VTAATVAEQARVAPSPTNK"
     atgtattgcc agaagtgtcg tactccgcta aaactggacg gttcccttga agcgctcaat        60
     ccggccgcct ttgacttgct tatcggttct acaggtaaag ctgtgccaga tccctcaact       120
     ggatcatctc gtctctccta tccccaggag cgtcgggatc tctacgatcg tgtttcgaaa       180
     aatgcatcat ccccggtata tcggaggtcg attccggcgc ctagacagtc tggcggcagt       240
     tcagctacac cgtccaggct ggggcgagga gatagtggca atatgtcgtt tgttatgctg       300
     acagagtccc aactcggccc atcgcatact atccctggag taaatggcga tagcgcgtcg       360
     tccaagggca aacgtgcatc cggggtacag ggcgacgatt ccggcgcaga taatgggtca       420
     tttgcggaac aggttgagcg aacctgtcgt ttgtttgaga ttatctcggc tcgttctgat       480
     attgatcatc cgatttgcac agaatgtacg gatatgctgg tcgaggggct acaacagcgg       540
     cttgcggagg cgacgaagga gcgggacgca tacatcacct ttctacggaa cctgaactcg       600
     tcggtcccaa cacaggagga ggttgaaaca gctgagaagt ctcttaaaga gactttggaa       660
     gccgaggagg cggcatacgc agaactggtt gcgttggaaa aggaaaatgc tgccttggac       720
     gaggagattg ctcggttaga agaggagtct cgccaactag attacgaaga ggaaaagttt       780
     tggcgcgatc ggaatgcgtt ctcgttggtg cttgctgatt tccagaatga gcgggatgcg       840
     ttgaatatga aatatgacca cgactctcgc cagctggaaa gactgcagcg aaccaatgtt       900
     tacaatgatg ccttctgtat tggccatgac ggctattttg gaacaatcaa cggcctccga       960
     ctcggccgcc tggcaaaccc ttcggtcgaa tggcctgaga taaacgctgc ctggggccag      1020
     actgcgctgc tgctggctac catagcggag aaactgaact ttcagttcca ggggtaccgg      1080
     ctgcggccga tgggctcgat gtccagaatc gataagatcg agtatccgcg accgtcaccg      1140
     gcgcaatcga ccgttgaagg agctagcaat gcccatcaac cagcggcacc caagatcacc      1200
     agccttgatc tgttctcctc aggcgacctg ccgctccata tcccatggct tcaccgccgg      1260
     ttcgatgcag gaatggtggc ctttctggaa tgtctacgtc aactggggga gtttgtggaa      1320
     aaaacacccg tacgctcgag tcgccgggac caggccggag ctgtcctgcc cggtttgaag      1380
     ttgccatacg ctatcaaacg agataagatt ggcgatgcca gtatcaagct tgggttcaac      1440
     caaaacgacg agacctggac gcgcgcctgc aagtatacct tgacgtgttg taaattcttg      1500
     ttggcccatg ctagcaacat tgctagcgca ggctcgacca actcagccgc tgtgacagca      1560
     gcaaccgttg ccgagcaagc cagagtggcg cccagtccta ctaacaaata g               1611
//

If you have problems or comments...

PBIL Back to PBIL home page