(data stored in ACNUC16935 zone)

EMBL: BN001307.PE357

BN001307.PE357       Location/Qualifiers
FT   CDS_pept        join(988148..988412,988466..989115)
FT                   /locus_tag="ANIA_01515"
FT                   /old_locus_tag="AN1515.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008142"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008142"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008142"
FT                   /db_xref="GOA:C8VMP8"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMP8"
FT                   /protein_id="CBF85024.1"
FT                   /translation="MLRDLLRDLVKFVPWAALLPLVRAEGTVQDLWNSPQYPDYTTNYT
FT                   AGTTIEISWQHALSYQFQYFCESCDVTNVDLWVTGSSYTRKLEAGMNVNETTSYEWTIN
FT                   LDNADVEASTQWTFRFLPADVSWGDNQEEISSARFNLLPRSDSSSTTTSSTSTSTSSST
FT                   TATSNPNATPTTDSATDGESSSTENHNDGLSTGAKAGIGVGVSAGAIILAALAFLLWRR
FT                   IKALPSTNAVGPEGPNGGYSQVHQGYFADPPMVKAAPVPASGVVAPMSELAGDHAGEMD
FT                   AGADARRPPVELDGSELYSHHGR"
     atgcttcggg atctgctccg ggatcttgtc aaatttgtcc cttgggcggc actattgccg        60
     cttgtaaggg ccgaagggac tgtgcaggat ctttggaact ctccgcaata tccagactat       120
     accacgaatt acacggccgg gacaacgatc gagatcagct ggcagcatgc actctcatat       180
     caattccaat acttctgcga gagctgcgat gtcacgaatg tggatctgtg ggtgacgggg       240
     agtagttata ctcgcaagct tgaggctggc atgaacgtca atgaaacaac aagctacgaa       300
     tggaccatca acctagacaa tgcggacgtt gaggcctcaa cacaatggac attccggttc       360
     ctccccgccg atgtttcctg gggcgacaac caggaggaaa tctcctctgc caggtttaac       420
     ctcctaccca gatcagacag ctcttcaaca accacttctt caacctccac atccacatct       480
     tcctcaacga cagccacctc taaccccaat gcaacgccca ccaccgacag cgcaactgac       540
     ggtgaaagct ctagcacaga aaatcacaac gatggtctct ccactggtgc caaagccggt       600
     atcggcgtcg gcgttagcgc aggcgccata atccttgccg cccttgcctt cctcctctgg       660
     cgacgcatca aagccttacc aagcaccaat gctgttgggc ccgaaggccc caatggagga       720
     tacagccagg ttcaccaggg atactttgct gatccaccaa tggtcaaggc tgcccctgta       780
     cctgcatctg gtgtggttgc tccgatgtcc gaattggcag gagaccatgc gggagagatg       840
     gatgcaggtg ctgatgctcg gcgaccgcct gttgagttgg acggaagtga gctttattca       900
     catcatgggc ggtag                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page