(data stored in ACNUC16935 zone)

EMBL: BN001307.PE359

BN001307.PE359       Location/Qualifiers
FT   CDS_pept        complement(join(992454..994253,994313..994480))
FT                   /locus_tag="ANIA_10215"
FT                   /old_locus_tag="AN10215.4"
FT                   /product="peroxisomal targeting signal (PTS1) receptor
FT                   protein peroxin 5 (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008144"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008144"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008144"
FT                   /db_xref="GOA:C8VMQ0"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR024111"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMQ0"
FT                   /protein_id="CBF85028.1"
FT                   /translation="MSFLGGAECSTAGNPLTQFTKHVQDDKSLQRDRLVGRAPGMQEGM
FT                   RSQGMMGGHDQMMDEFAQQSAQLPGGPQQHMRMEMEQVRQQLEQMHTTPRTGSPGWAAE
FT                   FDPGEQARMEAAFAGPKGPMMNNGSGFTPAEFARFQQQSTMSVPQSASPVTAGQSPMMG
FT                   GYQRSMGMGYMGYGGMGMMQPGFGPMGMQHQQPAEASTQDKGKGRMIELDDENWEAQFK
FT                   EIETADQGKLDDEANAAIEAELNDLDRSVPTTSSTEDLSHFERVWERVQAETATNRKLA
FT                   EDSEYNIDDNLHMGDMAEWDGFDNLNTRFREPRLGDYSFEQENVFRDIANPFEEGMKIM
FT                   QEGGNLSLAALAFEAAVQKDPQHVKAWTMLGTAQAQNEKELPAIRALEQALKVDPNNLD
FT                   ALMGLAVSYTNEGYDSTAYRTLERWLSVKYPQIISRDDLSSDADLGFTDRQILHERVTD
FT                   LFIQAAQLSPSGAQMDPDVQVGLGVLFYCAEEYEKAVDCFTTALASTESGTTNQREQLH
FT                   LLWNRLGATLANSGRSEEAIEAYEQALNINPNFVRARYNLGVSCINIGCYPEAAQHLLG
FT                   ALSMHRVVEEEGKERAREIVGGNDGRINEAELNRMITANQSTNLYDTLRRVFSQMGRRD
FT                   LADLVEAGMDVNIFRKEFEF"
     atgtcatttc ttggtggcgc tgagtgttcc accgcgggaa accccctcac gcagtttacg        60
     aaacacgtac aagatgacaa gtccctccag cgtgaccggc ttgtcgggcg tgcccctgga       120
     atgcaagagg gtatgcgctc gcagggaatg atggggggtc acgaccagat gatggacgag       180
     ttcgctcagc aatcagctca actccccggc ggcccgcagc agcatatgag gatggagatg       240
     gagcaagtga gacagcaact agagcagatg cacacaacgc cgcgaacggg ttcgccgggg       300
     tgggctgcgg agtttgaccc tggagaacaa gcccgcatgg aggctgcctt tgccgggcca       360
     aagggtccca tgatgaacaa cggatcgggg ttcactccgg ccgagtttgc ccgctttcag       420
     cagcagagca ccatgagcgt tccgcaatcg gctagcccag ttaccgccgg ccagtcacca       480
     atgatgggtg gttaccagcg atctatgggc atggggtata tgggatacgg agggatgggg       540
     atgatgcagc ctggattcgg acccatgggc atgcaacacc agcagccggc tgaggcttca       600
     acgcaggata aaggaaaggg gcggatgatt gagctcgacg atgagaactg ggaagctcag       660
     ttcaaagaga tcgagacggc agatcagggg aagctggatg acgaggccaa tgcagccata       720
     gaggcggagt tgaatgatct tgacaggtca gtccccacca ccagtagcac cgaagacctc       780
     agtcattttg agcgcgtatg ggaaagagtc caagctgaga cggcaacaaa tagaaaattg       840
     gcggaggatt ctgagtacaa tattgatgat aatctccata tgggtgatat ggccgaatgg       900
     gatgggttcg acaatctgaa tactcggttc agggagcctc gattgggtga ttactcgttc       960
     gagcaggaga atgtcttccg cgacatcgct aacccctttg aggagggtat gaagattatg      1020
     caagaaggcg gcaatctgtc cctggcagct ctggcttttg aggcggcggt gcagaaagac      1080
     cctcagcatg tgaaggcttg gactatgctg ggtactgccc aggctcaaaa tgagaaggaa      1140
     ctccctgcta ttcgggcact ggagcaagct ctcaaggtgg atccgaacaa tcttgacgcc      1200
     ctcatggggc ttgctgtgtc atacacgaac gaagggtacg actcaacagc ttaccgtacc      1260
     ctcgagcgct ggctttccgt taaatatcct cagatcatta gtcgagatga tctatcctcg      1320
     gacgccgacc taggattcac tgaccgccag attcttcatg aacgtgttac cgatcttttc      1380
     atacaggcgg ctcaattgtc gccgtcggga gcgcaaatgg atcctgatgt tcaggttggt      1440
     ctgggcgtcc tcttctattg cgcagaagag tacgagaagg ccgtggactg ctttacgaca      1500
     gcattggcga gcactgaatc cggaaccacg aaccagaggg agcaacttca tctcctttgg      1560
     aaccgcctgg gagctacgct cgccaactct ggtcgatcag aagaagctat tgaggcctac      1620
     gaacaagctc tgaacatcaa tcctaacttt gtccgagcgc gctacaacct aggcgtatcg      1680
     tgtatcaata ttggttgtta cccggaagca gcgcaacatc ttctgggagc cttgtccatg      1740
     catcgtgtgg tcgaggagga aggaaaggaa cgagctaggg agattgtagg cggcaatgat      1800
     ggtcgcatca acgaggccga actcaaccgc atgattactg caaaccaaag taccaacctt      1860
     tacgacacgt tgcgacgggt atttagccaa atgggtcgac gagacctggc cgatttggtg      1920
     gaagcgggaa tggatgtcaa tatattccgg aaggaatttg agttttga                   1968
//

If you have problems or comments...

PBIL Back to PBIL home page