(data stored in ACNUC16935 zone)

EMBL: BN001307.PE360

BN001307.PE360       Location/Qualifiers
FT   CDS_pept        complement(join(994869..995286,995362..996294,
FT                   996357..996358))
FT                   /locus_tag="ANIA_01517"
FT                   /old_locus_tag="AN1517.4"
FT                   /product="nucleic acid-binding protein (AFU_orthologue;
FT                   AFUA_8G05260)"
FT                   /note="transcript_id=CADANIAT00008145"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008145"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008145"
FT                   /db_xref="GOA:C8VMQ1"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMQ1"
FT                   /protein_id="CBF85030.1"
FT                   /translation="MYTLRRAACRLLASPSPITRSRLTALPHTHLPVVVRRPITQSRRS
FT                   LGDAKSPLGSKDAPAASTATNSDTTTATATADNALDLSPPVENYAEAVEKDVMKGDLKN
FT                   ELELSSGTTGAATARAVSTKETKQEDGGTCKNLNLKSSDSTRNTSGVPTAPEYEAGAEK
FT                   VREGRPSGTIIANTAPTGATSGVPRASSNAPGAEKAQTLNQGLAAKLSLSESLTKSTTV
FT                   DEQDPDLDFDISQIREAAAQEAWAAAEKKQMTHGEKLDMLRRLQYEPKQTVFIGNLFYD
FT                   VTAEDLKKQMAKYGVVEGVNIIYDSRGISKGYGYVQFSSNAAARRAIDAMHMRIFEGRR
FT                   VTLYYAQTNITNSFKNKKPTNTLYIGNVPFEMTDRDLNDLVKDLDGLTDVRVTVDRQSG
FT                   ALRGYIHAEFLDIQSAMVAHEKLAQRRPYGRRLKIDYSKTKSAQGGFPVAV"
     atgtacactc ttcgccgcgc cgcttgtcgc cttctggctt caccctctcc aataacccga        60
     tcaagattga cagcattacc ccacacacac ttacctgtgg ttgtccgccg gccgataacg       120
     cagagcagac ggtcactggg ggatgctaaa agcccgctgg gctcgaagga tgcccccgcg       180
     gcaagtacag caacgaattc ggatacgacc acggcaacag ccaccgcgga taatgcgcta       240
     gacttatcac caccagttga gaattatgct gaggcagtcg aaaaggatgt tatgaaaggg       300
     gacctgaaaa atgagctgga attaagtagt ggtactacgg gcgctgcgac agccagagcc       360
     gtttcgacga aagagaccaa gcaagaggat ggaggaactt gcaagaatct aaacctcaaa       420
     agttcagatt ccactagaaa tacgagtggt gtaccaacag cgcccgagta tgaggccggg       480
     gcagaaaagg tgcgagaagg gcgtccttcg ggcacgatta ttgcaaatac ggcaccgact       540
     ggggccacaa gtggcgttcc acgggcatcg tcgaatgcgc cgggggcgga gaaagcgcag       600
     acgctcaatc aaggcttagc tgccaagtta agtctttcag aatcattgac gaagagcaca       660
     acagtcgatg agcaggaccc cgatcttgat tttgatatat ctcagatccg cgaggcagcc       720
     gctcaagaag cgtgggcggc cgctgaaaag aaacaaatga cccacggcga gaagttagat       780
     atgctgaggc gattgcaata cgaacctaag caaacagtat tcattggaaa cctcttttac       840
     gacgtgacgg cggaagacct taaaaagcag atggcgaagt atggggtcgt ggaaggagtg       900
     aatatcattt acgacagccg gggcattagc aaaggatacg gctatgtgca atttagcagt       960
     aacgcggcgg caagacgggc aatcgatgca atgcatatgc gaatatttga ggggcgccgt      1020
     gtgaccctgt actatgcaca aaccaacata acaaatagct tcaagaacaa aaaacccacc      1080
     aacacacttt atattggcaa tgtgccattc gagatgaccg accgtgacct caacgatctc      1140
     gtcaaggatc tagacggtct tactgatgta cgggtgacgg tagaccgcca gtcaggggcg      1200
     ctccgtggtt acattcatgc tgagtttcta gatatccaaa gcgcgatggt tgcgcatgag      1260
     aagctcgcgc agaggaggcc ttacggacga cggctcaaga ttgattatag caaaacaaag      1320
     tcggcccaag ggggttttcc tgttgctgta tga                                   1353
//

If you have problems or comments...

PBIL Back to PBIL home page