(data stored in ACNUC16935 zone)

EMBL: BN001307.PE362

BN001307.PE362       Location/Qualifiers
FT   CDS_pept        join(1002190..1002431,1002501..1003600,1003654..1003898,
FT                   1003954..1005426)
FT                   /locus_tag="ANIA_01519"
FT                   /old_locus_tag="AN1519.4"
FT                   /product="RNA interference and gene silencing protein
FT                   (Qde2), putative (AFU_orthologue; AFUA_8G05280)"
FT                   /note="transcript_id=CADANIAT00008147"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008147"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008147"
FT                   /db_xref="GOA:Q5BD61"
FT                   /db_xref="InterPro:IPR003100"
FT                   /db_xref="InterPro:IPR003165"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014811"
FT                   /db_xref="InterPro:IPR032472"
FT                   /db_xref="InterPro:IPR032474"
FT                   /db_xref="InterPro:IPR036085"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD61"
FT                   /protein_id="CBF85033.1"
FT                   /translation="MSSAGGSPQRGSRGRGNDRGRGRGLFHGDRGRGRGGGRGLFNDLP
FT                   HRPAPGDPGRGGSRGRAGRGGRGGGGGLDQGPPIYLPPDGAPQPNVKVTQTENSQAAAL
FT                   VKKEKTAGYPERPGYGTQGHPIQLFANYLELKSSGKSLFRYHINIDGGGRKPSSRKAKQ
FT                   IICLLLEDHFSPFRHSIVTDYRSNLISHLEILDHEQPSVKYNVTYRSEKEDEPRDTSET
FT                   YRITCKFTGRLDPADLLNYLTSSNAASMLQEKAEILQALNIVLGHHPKSTGSIASVGTN
FT                   KHYAIHDNAAEKFDLGAGLEALRGYFVSVRAATARLLVNIQVKYVACYQDGPLYQVIRE
FT                   FQCANGRNVYALKRFLGRLRVEVTHIKRKNKRGEYIPRIKTITNLATPQDGTQDGNKCK
FT                   DAPKVKFIGAGPNDVSFFLDDPEQGKGSKKAGPKPSGTYITVAEFFKEYYRIQVDPDMP
FT                   VVNVGSIAKPSYLPVEVCDVLSGQPAKTKLSSNQTRQMLNFAVRSPAQNAHSIVTKGTQ
FT                   ILGLRDPTAATLVDFGIQTNPNLITVPGRVLAPPTVYYKDEKSKDKEIAPMSGSWNMKS
FT                   IRFSTSSNLQSWACILITAGPKQHFQSPDDLEDCLYRFTKKLREVGVNANPPVFKVRVQ
FT                   VTKENAETVIDAEIRKILHQHRPKLILTILPFNDTALYNCIKRACDVRHGVRNINVLAE
FT                   QFCKRNEQYFANVGLKFNLKLGGVNQVVRPSQLGIIGEGKTMLIGIDVTHPSPGSAKGA
FT                   PSVAAMVASVDSSLGQWPAEIRIQKEARKEMVDALDSMLKAHLRRWAANHKAAYPENII
FT                   VYRDGVSEGQYDHVTDEELPLLKNACKNIYPAPDTARNLPRFSIIIVGKRHHTRFYPTL
FT                   QEDADRFNNPVNGTVVDRGITEARNWDFFLQAHTALKGTARPAHYYTVWDEIFLRQKVI
FT                   PPAKNAADMLEAMTHHMCYLFGRATKAVSICPPAYYADLVCTRARCYLSSAFEPSTPSG
FT                   SVIGAEDSTVKVANDDVLIHPNVRDTMFYI"
     atgtcgagcg ccgggggatc accccaacga ggcagccgtg gaagaggtaa cgaccgcggt        60
     agaggacgcg gattgtttca tggtgatcgc gggcgaggcc gtggaggagg ccgtggcttg       120
     ttcaacgatc tacctcatcg accagcaccg ggtgatcctg gacggggagg ctccaggggc       180
     cgcgctggtc gtggtggccg cggtggtggt ggaggcttgg atcagggtcc tcctatttac       240
     ttgcctcctg acggtgcccc gcaaccgaat gttaaagtta ctcaaacgga gaactcccaa       300
     gcagcagccc tcgtcaagaa ggagaagact gcagggtacc ctgagcgacc cggttatggc       360
     acgcaggggc atcctatcca gctctttgcc aattacctcg aactgaaatc tagcggaaag       420
     agtctattta ggtaccacat aaatatcgat ggaggaggcc gcaaaccctc gtccaggaaa       480
     gcaaagcaga tcatttgttt gttacttgag gatcatttct ctccattccg tcacagcatc       540
     gtgaccgact acaggtctaa tctgatctcg catctagaaa tcctggacca cgagcagccc       600
     tcagtcaagt acaatgttac ttaccgtagc gagaaggaag acgagccgcg cgacacatct       660
     gagacctacc gtattacctg caaattcact ggccggcttg atcccgcaga ccttctcaat       720
     tacttgactt cttccaacgc agctagtatg ctccaggaaa aggcggaaat cctgcaggca       780
     ctgaatatag tcctcggcca tcatcctaag tccactggct ctattgcctc ggtcggtacc       840
     aacaagcact atgcaattca cgacaacgct gcggaaaaat ttgatctagg cgccggattg       900
     gaagctcttc gggggtactt tgtcagtgtc agagcggcaa cagcacgtct actcgtgaat       960
     attcaggtca aatatgttgc ctgttaccag gatggccctc tatatcaggt catccgcgag      1020
     tttcagtgcg ctaacgggag gaacgtttat gccttgaaga gatttctcgg cagactcaga      1080
     gtcgaggtca cccacattaa aaggaagaat aagagaggag agtatattcc aaggataaag      1140
     actatcacca acctcgccac cccccaggat ggaacccagg atggaaacaa gtgcaaggat      1200
     gcaccaaagg tcaagttcat cggggctggc ccaaacgacg tttcgttttt tcttgatgat      1260
     ccggagcagg gaaaggggag caagaaagct ggtcccaagc cctccgggac ctacatcact      1320
     gttgccgagt tttttaaaga atactacaga atccaggtag accccgatat gccagtggtt      1380
     aacgtcggaa gtatagccaa gccatcatat ctgcctgtgg aagtctgtga cgttctgtca      1440
     ggccaaccag caaagacgaa gctttcgtct aatcagacac gccagatgtt gaactttgca      1500
     gtgcgaagcc cagcgcaaaa tgcccattcc attgtcacaa agggaacgca aatattgggt      1560
     cttcgggatc ccaccgctgc cacgctggtg gactttggca ttcaaaccaa ccccaacctc      1620
     atcacagtac ctggccgagt tcttgctcct ccgactgtat attacaaaga tgagaaatca      1680
     aaggacaaag agattgcccc catgtccggc agctggaaca tgaaatctat cagattctcg      1740
     acaagctcca atcttcagag ctgggcctgt atccttatta ccgctgggcc taagcaacac      1800
     ttccaaagcc ctgatgatct ggaagactgt ctataccggt ttacgaagaa gctcagagag      1860
     gttggggtta acgcaaaccc tcctgttttt aaagttcgag tgcaggtaac gaaggagaac      1920
     gctgagacag tcatcgacgc agaaatacgt aaaatcttgc atcaacatcg gccgaagctt      1980
     atattgacaa ttctgccttt taacgacacc gcactctaca actgtattaa gagggcttgc      2040
     gatgttcgcc atggcgtacg caatatcaac gttcttgctg agcagttctg caagcgcaat      2100
     gagcaatatt tcgctaatgt cggcctaaaa ttcaatctga agctcggtgg cgtcaatcaa      2160
     gtcgtacgac cgagccagtt gggtataatc ggcgagggca aaacaatgct tattggtatc      2220
     gatgttacgc acccatctcc tggttctgct aaaggcgcgc ccagtgtcgc cgccatggtc      2280
     gcatctgtcg attcttctct cggccagtgg cccgccgaga ttcgtattca aaaggaagct      2340
     cgcaaggaga tggtcgacgc ccttgactcc atgcttaaag cacatctacg ccgctgggca      2400
     gctaatcaca aagccgcata ccccgagaac attattgtct accgtgatgg agtctcagaa      2460
     ggccagtatg accacgtaac cgatgaggaa ctgcccctcc tcaagaatgc ctgcaagaat      2520
     atctaccctg cgcccgacac agcaaggaac cttcctcgtt tttccatcat cattgttggc      2580
     aaacgccatc acacgcgctt ctacccaact ctccaggagg atgcagatcg cttcaacaac      2640
     cccgtcaacg gcacagtggt cgatcgcggc atcacagaag cccgcaactg ggactttttc      2700
     cttcaggccc atacagcact taagggaaca gcccgcccag cccattatta caccgtatgg      2760
     gacgagattt tccttaggca gaaggttatt cctcctgcca aaaacgcagc tgatatgctc      2820
     gaggccatga cccatcacat gtgctatctc ttcggtaggg caaccaaagc tgtcagcatc      2880
     tgtccgccag cctactacgc tgacctggtt tgcacgcgtg cccgttgcta tttaagcagt      2940
     gcttttgaac cctctacacc ctccggtagt gttattggtg ctgaagattc aacagtaaaa      3000
     gtcgctaatg acgatgtcct tatccatcct aatgtccggg acacgatgtt ctacatctag      3060
//

If you have problems or comments...

PBIL Back to PBIL home page