(data stored in ACNUC16935 zone)

EMBL: BN001307.PE363

BN001307.PE363       Location/Qualifiers
FT   CDS_pept        complement(join(1006220..1007530,1007601..1007906))
FT                   /locus_tag="ANIA_01520"
FT                   /old_locus_tag="AN1520.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008148"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008148"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008148"
FT                   /db_xref="GOA:Q5BD60"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD60"
FT                   /protein_id="CBF85035.1"
FT                   /translation="MSLKDVYQKFLASPNSASLASDVSLIYITSTTEINGADRVIKHLS
FT                   RQQELKINSQTVLDTVQGSNALCLDIETSLQFLTGGGAYLPNLDETFLFDRVAKFPTIH
FT                   IVRFNANNEIQSIRIYWDQASLLKQVEVIGNRSRNWPVRDADKQTRLIRFASESAPADN
FT                   GPPPAARPEPSSTGKDEAHEAPEAREGSPGKKHIKDPYAAESLFELLSPCKDRGEPVHR
FT                   PRAPASAQPPPRDYKELFVGDEGNDDAPETPSRARAIAPKVGAGKHFAPSRIFEPEEVE
FT                   PSPVVPKLGAGRHFAPSRIFGDDNETASREKPEQIAYRAHPKRFEHFELGGDNSSREIK
FT                   PTTSRPGSRHVKNWDFEDFSTPPKAKRGPRGEEVRHFGWSDDEPEQDTPPARPRVVQPR
FT                   RDAETHFQIADGEEQGNKRIIRSYGNKGLGLYKDTLYAEAEDLEAEGSAKQQASKERPL
FT                   SVVQNGPNRKKDFESHWDDPEATVSHENKKPTGDRVKAAKALESSWHFDKSPEPSKESR
FT                   PPQRRVLKNVNQRSWGFEDEE"
     atgtcgttga aggacgtgta tcagaagttc cttgcttccc ctaactcggc ttccctggcg        60
     tccgatgttt ccctgatcta tatcacctcc accaccgaga tcaatggcgc cgatagagtg       120
     atcaagcatc tctccaggca gcaagaactc aaaatcaatt cccagactgt ccttgacact       180
     gtacaaggct ccaacgcatt gtgcctggac attgagactt ctctgcagtt ccttacagga       240
     ggtggagcct atcttcctaa cctggatgag acgttcctgt ttgatcgcgt cgcaaaattc       300
     cccacgatcc atatcgtccg attcaacgcc aataatgaga tccaaagcat cagaatctac       360
     tgggaccagg cctccctgct aaaacaggtc gaggtcattg ggaaccgctc tcgtaactgg       420
     cccgttcgtg acgcggataa gcagactcgc ctgatcagat tcgcttccga atcagcacca       480
     gcagacaatg gacctccccc agcagctcga cctgagcctt catccactgg gaaagacgag       540
     gcccacgagg cccccgaggc ccgtgaaggc tctcccggta aaaaacacat caaggaccca       600
     tacgccgctg agtcgctatt cgagctcctc tctccctgca aagatcgcgg cgagcccgta       660
     caccgtcctc gtgcccctgc ttctgcgcag cctccacctc gtgactataa agagttgttt       720
     gtaggtgatg agggaaatga cgacgcgccc gaaacgccct caagagcgcg tgccatcgca       780
     ccaaaggtcg gcgcaggcaa gcacttcgcc ccgtcgcgca ttttcgagcc tgaagaggtt       840
     gagccttctc cagtcgtacc caagctcggt gccggtaggc acttcgctcc ctctcgcatc       900
     ttcggcgacg ataacgagac cgcctctcga gaaaagccag agcagatcgc ttaccgcgcg       960
     caccccaagc gatttgaaca tttcgagcta ggtggtgata acagcagccg cgagattaag      1020
     ccaactacct cgcggcctgg ttcccgtcac gtcaagaact gggactttga agatttttca      1080
     actcccccaa aggccaaacg cggaccccgt ggtgaagaag tccgccattt cggctggagc      1140
     gacgacgaac ctgagcagga cacaccccca gctaggcctc gcgtcgtaca accccggcgt      1200
     gacgccgaga ctcatttcca aatcgcggat ggtgaagagc aaggcaacaa gcgcattatc      1260
     cggtcatacg gcaacaaggg cctaggcctt tacaaggaca ctctgtacgc tgaggcagaa      1320
     gacctcgagg ccgagggaag cgccaagcag caagccagca aggagcgtcc cctctcagtt      1380
     gtccaaaacg gaccgaaccg caagaaggat tttgagagcc actgggatga cccggaggcc      1440
     actgtaagcc acgagaacaa gaagcccaca ggcgatagag tcaaggctgc taaggcattg      1500
     gagtcttcgt ggcactttga taagtcccct gagccaagca aggaatcgcg tcctcctcag      1560
     cgtcgggtat tgaagaatgt caaccagcgg agctggggat tcgaggacga ggagtag         1617
//

If you have problems or comments...

PBIL Back to PBIL home page