(data stored in ACNUC16935 zone)

EMBL: BN001307.PE364

BN001307.PE364       Location/Qualifiers
FT   CDS_pept        complement(join(1008887..1008896,1008959..1009128,
FT                   1009189..1009269,1009319..1009567))
FT                   /locus_tag="ANIA_01521"
FT                   /old_locus_tag="AN1521.4"
FT                   /product="RNA polymerase II subunit 7 (AFU_orthologue;
FT                   AFUA_8G05300)"
FT                   /note="transcript_id=CADANIAT00008149"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008149"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008149"
FT                   /db_xref="GOA:Q5BD59"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR005576"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR036898"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD59"
FT                   /protein_id="CBF85037.1"
FT                   /translation="MFFLKEETKVITLHPSYFGPNVREYLINRLNEEEEGRCTGDHFVI
FT                   CVMDMVDIGEGRVLPGNGQAEYTIKYRAIIWKPFRGETVDALVTSVKPTGIFTLAGPLS
FT                   VFIARKNIPSDIRWEPNTVPPQYTDHADQVIEKGTSLRLKILGVKPDVAAINAIGTIKE
FT                   DYLGPL"
     atgtttttcc tcaaagaaga gacaaaggtc atcactctac atccctcgta cttcggcccg        60
     aatgtgcgag aatacctcat caaccgcttg aatgaggagg aagaagggcg gtgtaccgga       120
     gatcattttg taatatgcgt catggacatg gtagatatcg gcgagggaag agtgctcccg       180
     gggaacggac aagcggaata tacgataaag tatcgagcaa ttatctggaa acctttcagg       240
     ggagagaccg ttgatgctct tgtcacatca gtcaaaccta cgggcatctt caccttggct       300
     ggtccgttgt cggttttcat tgcgcgcaaa aatatcccct ccgacatcag gtgggagccc       360
     aacacagtgc cgccgcaata caccgaccac gcggaccagg ttattgagaa aggtaccagt       420
     ctgcgactga agattcttgg tgtgaagcca gacgtcgccg cgatcaatgc gattggaaca       480
     atcaaggagg attatttagg accactctaa                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page