(data stored in ACNUC16935 zone)

EMBL: BN001307.PE365

BN001307.PE365       Location/Qualifiers
FT   CDS_pept        join(1010338..1010370,1010509..1010568,1010632..1011084)
FT                   /locus_tag="ANIA_01522"
FT                   /old_locus_tag="AN1522.4"
FT                   /product="DUF962 domain protein (AFU_orthologue;
FT                   AFUA_8G05310)"
FT                   /note="transcript_id=CADANIAT00008150"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008150"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008150"
FT                   /db_xref="GOA:Q5BD58"
FT                   /db_xref="InterPro:IPR009305"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD58"
FT                   /protein_id="CBF85039.1"
FT                   /translation="MALNLEKQLLFVNVAIHITCVPILLFTGIAMASNSPPLIKLPEVL
FT                   QFEDLPPNIGTIAALFYAIFYVLLEPVAGTLIAPLLLGAAALGNRLIATYGMTVNYWFG
FT                   GIHVVSWLLQFVGHGAFEGRAPALLDNLVQALLLAPLFVWMEILFFFGYRPELRARYEA
FT                   SVKKEIAAFKEKRNKALK"
     atggcgttga acctcgagaa gcagctcctc ttcgtgaacg tagcgattca tataacatgt        60
     gtgccgatac tcttatttac cggcattgca atggcatcga actcccctcc tcttatcaag       120
     ttacctgaag tcctgcaatt cgaagactta cctccgaaca tcggaacgat cgcagcgctc       180
     ttttatgcta tcttctatgt cctcttggag cctgttgctg gcactctaat cgcaccactc       240
     ctactcggcg ctgcagcctt gggtaaccgc ctcatagcta cttatggaat gacagtcaac       300
     tactggtttg gtgggattca tgtggtatcc tggttgttgc agtttgtcgg ccacggtgcc       360
     ttcgaaggcc gtgccccagc gctgttagac aacctggttc aagctttgct ccttgcgcct       420
     ctcttcgtgt ggatggagat cctcttcttc ttcggttatc gcccagagct gagggcacga       480
     tatgaggcta gtgtgaaaaa ggagatcgca gcgttcaagg aaaagagaaa caaagcgttg       540
     aaataa                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page