(data stored in ACNUC16935 zone)

EMBL: BN001307.PE369

BN001307.PE369       Location/Qualifiers
FT   CDS_pept        join(1017727..1017776,1017837..1017870,1017922..1018288,
FT                   1018348..1018509,1018577..1018764)
FT                   /locus_tag="ANIA_01526"
FT                   /old_locus_tag="AN1526.4"
FT                   /product="DUF850 domain protein (AFU_orthologue;
FT                   AFUA_8G05350)"
FT                   /note="transcript_id=CADANIAT00008154"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008154"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008154"
FT                   /db_xref="GOA:Q5BD54"
FT                   /db_xref="InterPro:IPR002809"
FT                   /db_xref="InterPro:IPR008568"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD54"
FT                   /protein_id="CBF85046.1"
FT                   /translation="MALQGVEQTILRDPALFYWILIPISVVMILTGMLRHYATILMNSP
FT                   PKPPATLAESRERLSLFRAVNLRNHAPAVLSKEAFEMRKNYLVTGFQTGAFLKDPNSRG
FT                   QPPANPMSDPAAMEGMMGMMKGNMMMMIPQTLIMSWINAFFSGFVILKLPFPLTIRFKS
FT                   MLQSGVMTRDLDVRWVSSLSWYFLNLFGLQSVFGFILGSDNAANHMAQQMGPMGPAAGA
FT                   NPFQPGQDPHKMYLNEAENLEVFEHFSILDGIEDRVLRKYGAAQ"
     atggcattgc aaggtgtaga gcaaacgatc cttcgggatc cggctctatt ttactggatt        60
     ttgattccta tctccgttgt catgattctg accggcatgc tccgacacta tgctacaatc       120
     ctaatgaact cccctccgaa gcctcccgcg accctagcag aatcccgcga gcgcctctcc       180
     ctgttccgcg ccgtcaacct gcgtaaccac gccccagctg tgctgtcgaa agaggctttt       240
     gagatgcgaa aaaactacct tgtcacgggc tttcaaaccg gcgccttttt gaaggacccc       300
     aacagtcgcg gccagccacc cgctaaccca atgtcagatc ccgctgctat ggagggcatg       360
     atgggaatga tgaagggaaa tatgatgatg atgattccgc agaccctgat tatgagctgg       420
     ataaatgctt ttttttcggg cttcgtcatt ttgaagctcc cgttccctct taccatccgc       480
     ttcaagtcga tgctgcagtc tggtgtcatg actcgtgact tagatgtgcg atgggtgtcc       540
     agtctgtctt ggtatttcct gaacttgttc gggctgcagt ctgtttttgg atttattctc       600
     ggcagtgata acgctgccaa ccatatggct cagcagatgg gcccaatggg tcccgctgct       660
     ggagcaaatc cgttccagcc tggccaagat ccgcataaaa tgtacctgaa cgaagcagaa       720
     aacctcgagg tttttgaaca tttcagcatt ctcgatggca ttgaggatag agttctgcgc       780
     aaatatggtg ctgctcaata g                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page