(data stored in ACNUC16935 zone)

EMBL: BN001307.PE37

BN001307.PE37        Location/Qualifiers
FT   CDS_pept        complement(join(99793..102406,102752..102813))
FT                   /locus_tag="ANIA_09025"
FT                   /old_locus_tag="AN9025.4"
FT                   /product="Putative transcription factor with C2H2 and
FT                   Zn(2)-Cys(6) DNA binding domain (Eurofung)"
FT                   /note="transcript_id=CADANIAT00007828"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007828"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007828"
FT                   /db_xref="GOA:Q5ARQ5"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARQ5"
FT                   /protein_id="CBF84438.1"
FT                   /translation="MEKIELRAGREIRSHVKLPERMHSCQVCDKTYQTRGSLTRHLRNH
FT                   SVNDSQHVCPTCGVAFSRRDLLRRHVRIHRLAQNNLNTTTTSNDLATPAPRRRCHTACQ
FT                   PCREARVKCDGGNPCSQCIATQTECLLGSRTGRVSRVVEKERRQEQYSHSDDGGSAGED
FT                   DKEDGDQEQDFSRVRVETSITAAPAMLHSPVSNVDAPIIPFLGSEDPLPDMDNIDHLAE
FT                   MDFSWTDSLPCTTTSWPWLHESLLLQGNPLLNWTNDSIYALDTGDMVPDSCPGIIPLDT
FT                   AQQLPVISPTKTVTSMSARDDAESGSAPPSEPGKPETRLQGPDMPEFQGQAALQQDQIV
FT                   EELVAYAEKRIVTPGSKLSRSLFWQSMSIRIAEAFRIDPCDSPGSESTLNRLMQIYKEN
FT                   FSPLWPLLSGKEFDSSELHPLLFLTVVSIGCMYGTSQECNFGNKLHERVRRCLAASLIG
FT                   LEDAEGDILWLGRARLLTQVAALYFGQRRAFSYAQHVGAITLAQARRMDLFSTVGRPGM
FT                   TGELSLEQQTVLWQNAEARKRLAFGILRADVFTSVLLNTRPLLSAEEIYLDLPASDEIW
FT                   MNLDTIPLEQLASRLKDESSRALGLPFCDLVRVASDRGEALLNMNPRGYELLIFGLQEY
FT                   VWRFSHDRSMFPRLIGQSDHTVAQKENLPSSPNGLSISASLQTDQLGRTYRRMNDLRND
FT                   RCRITQTLQRWEQSFTSTRTTQSFGQDRTSVMSSLLLLYISYLRLCVPLADLHSAAYIL
FT                   MDNKPLEPKKLQTLQEWAKGTGAVEAIKHVCQIWSLLSQERFRTGTDKAKYNLLSFSGL
FT                   HHAAVVIWTFAGVHSEPVAEVAELPGWRDMAPISIQRDQTRSLLRAVVSLYKHLIPRGW
FT                   YSFAAVAESLAAQPFPDSSR"
     atggagaaga ttgagttaag agctggccgc gagattcgaa gccacgtgaa attacctgaa        60
     aggatgcatt catgtcaagt gtgcgacaag acgtaccaga cgcgtggctc cttgactcga       120
     cacctgcgaa accattccgt caatgatagc cagcatgtgt gcccaacgtg cggggtggct       180
     ttttctcgcc gcgacctctt gcggcggcat gttcgaatcc accgccttgc gcaaaacaac       240
     ctcaacacga ccacgacgtc caacgatctc gccacgcctg ctccgcgacg tcgctgtcat       300
     acggcgtgtc agccttgtcg agaagcgcgg gtgaaatgtg acggaggcaa tccctgctcc       360
     cagtgtatcg caacgcaaac agagtgcctg ctcggatccc gtactgggcg tgtgagccgc       420
     gtcgtcgaga aagaacgtcg gcaagagcag tattctcatt ccgatgatgg agggtcagct       480
     ggagaggacg ataaggaaga cggcgaccag gagcaagatt tctcgagggt aagggtcgaa       540
     acttccataa cagcagcgcc agccatgctt cactcaccag tctcgaatgt tgatgctccg       600
     ataattccct tcttggggtc cgaggatccg ttgcccgaca tggacaatat agaccatttg       660
     gccgagatgg acttcagctg gacggactct ttgccttgca ctaccacttc atggccttgg       720
     ctgcatgaga gtttactctt acaaggcaat cccttgctca attggaccaa tgactccatc       780
     tacgcccttg atactggtga tatggttcca gactcttgcc caggcattat acccctcgat       840
     acggcacaac aactgcctgt tatatccccc accaagaccg tcacctcgat gtcggcaaga       900
     gatgatgccg agtctggttc cgcaccgcca tcagagccag gaaaaccaga gacccgactg       960
     cagggacccg atatgcccga atttcaaggt caagcagccc tccagcaaga tcaaatagta      1020
     gaagagctcg tggcctacgc ggagaagcga attgttactc cagggtccaa gctctctcga      1080
     tccttgttct ggcagtccat gtcgattcga atcgcagaag catttcgcat cgatccttgc      1140
     gactcacctg ggtcggagtc aaccttgaat cgcctgatgc agatttacaa agaaaacttt      1200
     tccccgttgt ggccattgct gagtggaaag gagtttgact ccagcgaact tcaccccttg      1260
     ctctttctga ctgttgtttc gattggatgc atgtatggga cctcccaaga atgcaatttc      1320
     ggaaacaagc ttcacgaacg agtccgtcgt tgtctagcgg catctctgat tgggcttgag      1380
     gatgctgaag gcgacatact ttggctcggg cgggcccggc tgttgactca ggtcgcggct      1440
     ctatattttg ggcaacggcg ggctttctct tacgcccaac acgttggtgc gataactctc      1500
     gcacaggcac ggcgaatgga tttgttctct accgtgggcc gtcctggcat gactggggaa      1560
     ctttctctcg aacaacagac tgtgctttgg caaaacgcgg aggccaggaa gcggctcgcc      1620
     ttcggaattc tcagagcaga tgtcttcaca agcgtgcttt tgaacacgcg gccactgttg      1680
     tcggctgaag agatctacct agatctccct gccagtgatg aaatttggat gaacctggat      1740
     accattcctc tggagcagtt ggcctcccgg ctgaaagacg agtcttcgcg ggcattgggg      1800
     ctcccattct gcgatttggt tagagttgcg agcgaccgcg gggaggccct ccttaacatg      1860
     aacccaaggg gatatgagct cctgattttc ggccttcaag agtatgtttg gagattcagc      1920
     cacgaccgaa gcatgttccc gcgcctcatc ggccagtcgg atcatactgt cgcccagaaa      1980
     gagaatctac cttcctcccc gaacggtctt tcaatctcag catcgttaca gactgaccag      2040
     cttggtcgta cctatcgtcg aatgaatgat cttcgaaacg accgttgccg cattacccag      2100
     accctacaga gatgggagca aagcttcaca tcaactcgca ctacacaatc gttcggccaa      2160
     gataggacca gtgtgatgag cagcttactc cttttgtaca tctcatacct gaggctatgt      2220
     gtgcctcttg ctgatcttca ttcggccgcg tacatcctca tggacaacaa acctctggaa      2280
     ccaaagaagc tacaaacact tcaggagtgg gcaaaaggaa caggggcagt tgaagccatc      2340
     aaacacgtgt gtcagatttg gtccctcctg agccaagaaa gatttcgcac cggtaccgac      2400
     aaggcaaaat acaatcttct ttccttttcg ggcttacatc acgcggcagt cgtgatctgg      2460
     acctttgccg gggttcatag tgagcctgtt gctgaagtcg ccgagctgcc tggatggagg      2520
     gatatggcac caatctccat tcaacgagac caaacccggt cgcttctgag agcggttgtc      2580
     agtttgtaca agcacttgat accaagaggt tggtattctt ttgcggccgt cgcagaaagc      2640
     ttagctgcac agccattccc ggactctagc cgctag                                2676
//

If you have problems or comments...

PBIL Back to PBIL home page