(data stored in ACNUC16935 zone)

EMBL: BN001307.PE370

BN001307.PE370       Location/Qualifiers
FT   CDS_pept        complement(join(1019000..1019086,1019141..1019776))
FT                   /locus_tag="ANIA_01527"
FT                   /old_locus_tag="AN1527.4"
FT                   /product="FAS1 domain-containing protein AN1527 Precursor
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5BD53]"
FT                   /note="transcript_id=CADANIAT00008155"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008155"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008155"
FT                   /db_xref="GOA:Q5BD53"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="InterPro:IPR040200"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5BD53"
FT                   /protein_id="CBF85048.1"
FT                   /translation="MRQLSTTALVLFLFFYCSISTAWSLPYFAYRKRIPEPLLNKPRSR
FT                   HARSIEDLDGLKEWLSNQQPLRGAVMAPPSEDNKRTVTVKGGANNEPTISDVLPKTRGI
FT                   NIYASLTRQFETVERRLKDQTQNVTVLAPRNSAIQDLPHKPWENPDDYEKFGEMNAYEG
FT                   DKGQDRAKRNLERFVSAHVVAQSPWREGEEAETLGGDKLTWRKDGDRIYIEPERIRVES
FT                   IAEQVSNGEVWVIDGVIN"
     atgcgacagc tatcaacaac agcactcgtt ctcttcctgt tcttctattg cagtatctca        60
     acagcgtgga gcttgccata ctttgcatat cgcaagcgta tcccggagcc gttactcaac       120
     aagcctcgct cacgccacgc gcgaagcata gaggacctcg acggactcaa ggagtggttg       180
     agcaaccagc agccgcttag aggagcagtg atggcacccc catcagagga taataagcgg       240
     acagtgaccg tgaagggcgg ggccaataat gagcccacta tatctgacgt cctgcccaag       300
     acccgcggta tcaacatcta cgcatcactc acccgccagt ttgaaaccgt cgaaaggcgg       360
     ctaaaggacc aaacacaaaa tgtgacggtt ctggcacctc gtaatagtgc tatccaagat       420
     cttccgcaca agccctggga gaatcccgat gattacgaga agttcgggga aatgaacgcg       480
     tatgagggag acaagggaca agatcgggcg aaacgtaacc tggaacggtt tgtttctgct       540
     catgttgtgg ctcagagtcc ttggagggag ggagaggagg cggaaacact tggaggagat       600
     aagttgacgt ggagaaaaga cggggacaga atatatatcg agccggaaag aatcagggta       660
     gagagcattg cagagcaggt ttctaacggc gaggtatggg taatcgatgg ggttatcaat       720
     taa                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page