(data stored in ACNUC16935 zone)

EMBL: BN001307.PE373

BN001307.PE373       Location/Qualifiers
FT   CDS_pept        complement(join(1026514..1027352,1027428..1027653))
FT                   /locus_tag="ANIA_01531"
FT                   /old_locus_tag="AN1531.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008157"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008157"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008157"
FT                   /db_xref="GOA:Q5BD49"
FT                   /db_xref="InterPro:IPR031398"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD49"
FT                   /protein_id="CBF85052.1"
FT                   /translation="MPSIVRFGRPKKSSKPETENANSTPHVSATPNSFRAPRISLPHVD
FT                   AELNMAQHNGLFEVDPPERQKGTEAAETIMDSTSPPPSYISNASANPMNGDATGAEWSS
FT                   AVGHAATGKSGRVIHNLQEDIARLTRECSVYRSRAEETQRMNEAFKTQVQNMTDRLRNL
FT                   EHSNEMNLHSLSRKEKKIEELRAELKGERDRRQQADDEKARFRQLMDEAQDGFHQKCAE
FT                   LQEIAHHAQTQYDVLVKSGQRERADQQRRLKNIRDEFIALREAHNQTNSQLSQLDAIMA
FT                   QKDQEIERGRANFDALFKEYEAYKRAHDEEVRDLIKQTRQGEAKFNATLASLKETESQM
FT                   KWVVQVKREVKDAE"
     atgccgagca tagttcgatt tggtcggccc aagaagtcat ctaaaccaga gactgagaat        60
     gctaactcca ctccccatgt atcagctaca ccgaattcgt tccgagctcc tcgtatcagt       120
     ttgccccatg tcgatgcaga gctgaacatg gcacagcaca atgggttgtt tgaggtcgac       180
     cctcccgagc gacaaaaagg cacggaggcc gcagagacca taatggatag cacaagtccg       240
     cctccgagct acatcagtaa tgcgtcagca aaccccatga acggcgatgc aactggagca       300
     gaatggtcct ccgccgttgg tcacgcagct acgggcaagt ccggtcgtgt catacacaat       360
     ttacaagagg atatcgcgcg gttgactcgc gaatgcagcg tttaccggtc tcgcgcagag       420
     gaaacgcagc ggatgaacga agccttcaaa actcaagtac aaaacatgac cgatcgtctc       480
     cggaaccttg aacactcgaa cgaaatgaac ctacattcac tctcgcggaa agaaaaaaag       540
     attgaggaac tgcgcgctga gctgaagggc gaacgggaca ggcggcagca agcggatgac       600
     gagaaagcca gattccgcca attgatggat gaagcgcagg acggtttcca tcaaaaatgt       660
     gctgaacttc aagaaatcgc tcatcatgcc caaactcagt acgatgtgct cgtgaaatca       720
     gggcagcgcg aacgggcgga ccaacaacgg aggctgaaaa atatacgaga cgaattcatt       780
     gcattgaggg aagcgcacaa tcaaacaaat tcacaattaa gtcagttgga cgccatcatg       840
     gctcagaaag atcaagagat tgaacgcgga cgcgccaact ttgacgctct atttaaggag       900
     tacgaggcct acaagcgagc gcatgacgaa gaggtgcgag acttaataaa acaaacccgg       960
     caaggcgagg cgaagttcaa cgctacactt gcgtctttga aggaaaccga aagccagatg      1020
     aaatgggttg tacaggttaa acgcgaggtc aaggacgccg aatga                      1065
//

If you have problems or comments...

PBIL Back to PBIL home page