(data stored in ACNUC16935 zone)

EMBL: BN001307.PE374

BN001307.PE374       Location/Qualifiers
FT   CDS_pept        complement(join(1028839..1029282,1029330..1029470))
FT                   /locus_tag="ANIA_01532"
FT                   /old_locus_tag="AN1532.4"
FT                   /product="extracellular matrix protein, putative
FT                   (AFU_orthologue; AFUA_8G05410)"
FT                   /note="transcript_id=CADANIAT00008158"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008158"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008158"
FT                   /db_xref="GOA:C8VMR4"
FT                   /db_xref="InterPro:IPR018466"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMR4"
FT                   /protein_id="CBF85054.1"
FT                   /translation="MHPLRPLLATWACLAQVSFAAVSFTKWPTTIHTGKPATVYWKGDS
FT                   DTPVTITLRQGPAGNLRTLKVLTHDAQGGSFTWVPDESLAPGSDYALQIEQDGSINYSG
FT                   LVTLVDQSGKKPQPSASKHTPVSSPLGGARTSVQKGNNGYIPTLNSSSARVNMTSGKST
FT                   AHKTSNDGVTFRYISAEMILAAMAAVVYFAA"
     atgcatcccc tcaggcctct tctcgcaacc tgggcgtgtt tagcccaggt cagtttcgca        60
     gcagtatcat tcacaaagtg gccaacgacc attcataccg gaaagccagc cactgtttat       120
     tggaagggtg attcggatac tcctgtcacg attacactgc gacaagggcc cgccggcaac       180
     cttagaactc tcaaagtcct cacgcatgac gcacagggag gctccttcac atgggttccc       240
     gacgagtccc tcgcccccgg ctcagactat gccttgcaga ttgaacagga tggcagcatt       300
     aactactctg gccttgtgac tctcgttgac caatctggga aaaagccaca accatcagct       360
     tccaaacaca cacctgtttc ctctccgctc ggcggtgcga gaactagtgt ccagaaaggt       420
     aacaatggct atattcctac tctgaatagt tcgtctgccc gggtcaacat gacgtcgggt       480
     aaaagcacag cacacaaaac atccaacgac ggcgttacct tccgatacat ttctgcagag       540
     atgatcctgg cagccatggc tgctgtcgtt tattttgccg cttaa                       585
//

If you have problems or comments...

PBIL Back to PBIL home page