(data stored in ACNUC16935 zone)

EMBL: BN001307.PE375

BN001307.PE375       Location/Qualifiers
FT   CDS_pept        complement(join(1030026..1030152,1030310..1030347,
FT                   1030387..1030446))
FT                   /locus_tag="ANIA_11305"
FT                   /old_locus_tag="AN11305.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008159"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008159"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008159"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMR5"
FT                   /protein_id="CBF85056.1"
FT                   /translation="MSYGVERKGFEMELMCVSYGVQRVTSQSGLYHLQEEPEMAGTPLV
FT                   SLKHGEADVTSAFGSIPKPTAKSQCVFSL"
     atgtcatacg gtgttgaaag aaaagggttc gagatggagt taatgtgtgt atcgtacgga        60
     gtgcaacgag tgacttctca aagcggatta tatcatttgc aagaggagcc ggaaatggcc       120
     ggaaccccgt tggtgtctct caaacatggt gaggccgatg tcacttccgc attcggcagt       180
     attcccaaac ccacagcgaa gagccagtgt gtttttagtc tgtga                       225
//

If you have problems or comments...

PBIL Back to PBIL home page