(data stored in ACNUC16935 zone)

EMBL: BN001307.PE377

BN001307.PE377       Location/Qualifiers
FT   CDS_pept        join(1033617..1033647,1033712..1034160,1034243..1034465,
FT                   1034524..1034549)
FT                   /locus_tag="ANIA_01534"
FT                   /old_locus_tag="AN1534.4"
FT                   /product="ATP synthase subunit 4, mitochondrial precursor
FT                   (Broad)"
FT                   /note="transcript_id=CADANIAT00008161"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008161"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008161"
FT                   /db_xref="GOA:Q5BD46"
FT                   /db_xref="InterPro:IPR008688"
FT                   /db_xref="InterPro:IPR013837"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD46"
FT                   /protein_id="CBF85060.1"
FT                   /translation="MASRLAKSAIGVTRLRPTLASRNVAAVTLSATRAASNVPTEDPKQ
FT                   KAQSILDSLPGNSLVSKTAILSATAGLSIAAISNELYVMNEETVAAFCLLSVFTAVAKY
FT                   GGPAYKEWAEAQVQKHKDILNAARADHTNAVKQRMENVKELSGVVDLTKQLFEVSKETA
FT                   KLEAQAYELEQRTALAAEAKQVLDSWVRYEGQVKQRQQRELAETVIGKIQKELQNPKTL
FT                   QQILNQSVADVERIMSSKAQ"
     atggcttcgc gtcttgctaa gagcgccatt ggcgtcaccc ggctgcgccc gaccctcgcc        60
     tcgcgcaacg ttgctgccgt caccctctcc gcaacccgtg ctgcttccaa cgtgcccacc       120
     gaagacccca agcagaaggc tcagtccatc cttgactctc ttccgggcaa ctctctggtc       180
     tccaagactg ccatcctttc cgccaccgcc ggtctctcca tcgccgccat cagcaatgag       240
     ctttatgtga tgaacgagga aaccgttgca gccttctgtt tgctcagtgt tttcaccgct       300
     gttgccaaat acggtggtcc tgcatacaag gaatgggctg aggctcaggt ccagaagcac       360
     aaggacatcc tcaacgctgc ccgtgccgac cacaccaacg ctgttaagca gcgcatggag       420
     aatgtcaagg agctgtctgg tgttgttgac ctcaccaagc agctctttga ggtttccaag       480
     gaaaccgcca agctcgaggc ccaggcctac gagctcgagc agcgcaccgc tcttgctgcc       540
     gaggccaagc aggttcttga ctcgtgggtc cgctacgagg gccaggtcaa gcagcgccag       600
     cagcgtgagc ttgctgagac cgtcattggc aagatccaaa aggagctcca gaaccccaag       660
     accctccagc agatcctcaa ccagagcgtt gctgacgttg aacgcatcat gtcctccaag       720
     gctcagtaa                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page