(data stored in ACNUC16935 zone)

EMBL: BN001307.PE378

BN001307.PE378       Location/Qualifiers
FT   CDS_pept        join(1035484..1036035,1036089..1036128,1036199..1036292,
FT                   1036359..1036665,1036814..1036878,1037225..1037342)
FT                   /locus_tag="ANIA_01535"
FT                   /old_locus_tag="AN1535.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008162"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008162"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008162"
FT                   /db_xref="GOA:Q5BD45"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD45"
FT                   /protein_id="CBF85062.1"
FT                   /translation="MPLRDILHKKDRLNNTSDQYATDTLDAANSVPEIRFIRSDTTTQE
FT                   IIIPPNHDVDHEDRLASPRPSSSSSHRRTLNPFHRSRTPPDPQDPGSPRERRFSGFLRR
FT                   GSSSSSVNLPPDLPQIAADAGDEQEREAQWEKRATVLAQQSPRYGSPSHSPAPSMGLGS
FT                   ENVRPRSRSSSHSRINDPQGDVNILEAIRLHEAGELEQSTSMFAQLADTTGANNALSQV
FT                   LYGLALRHGWGCRPDPEKAVVYLSAAASNSASIEAQALEAGLKKGGAAKGELVLAIFEL
FT                   GNCFRNGWGVKKDPAAARQYFETAANLGDTDAMNEVAWCYLEGFGGKKDKFMAAKYYRL
FT                   AESKGNKIVGNSCKSAHLQPLSKTGTRHLGAPAQPYHAPQPYHAPGSRTDG"
     atgccgctgc gcgacatcct ccataagaaa gaccggttga ataataccag cgaccaatat        60
     gcgactgaca cactagatgc tgcgaattcg gtgcctgaga taaggttcat tcgctctgac       120
     accactactc aagaaatcat cattccaccc aaccacgacg tcgaccatga agatcgtcta       180
     gcctcgccgc ggccttcctc ttcctcctcc caccgaagaa cgttgaaccc attccatcgc       240
     tctagaacgc cgcccgatcc gcaagaccca gggtcgccaa gggagcgccg gttttctggt       300
     ttcctgcggc gaggctcctc ttcgtcttcc gtcaatttgc cgccggacct tccgcagata       360
     gcagccgatg ctggtgatga gcaagagcgc gaagcacaat gggaaaaaag agcgactgtc       420
     cttgcgcagc agagcccacg gtacgggtct ccgagccatt cgccagctcc ttccatgggg       480
     cttggttcgg agaatgtacg acctcggtct agaagttcca gtcacagccg aattaatgac       540
     cctcaaggag acgtcaatat cctagaggcg atccgacttc atgaagctgg ggagttggag       600
     cagtcaacaa gcatgtttgc acagttagcg gacacaaccg gtgcgaacaa tgccctaagt       660
     caggtgctct atggtcttgc tctaagacat ggctggggtt gcagaccaga cccagaaaaa       720
     gcggtcgtgt acctctcagc cgcggcgtcc aattcggctt ccattgaagc ccaagccctc       780
     gaggcagggc tcaagaaagg cggcgccgct aaaggcgagc ttgtcctagc gatctttgaa       840
     ttaggaaact gctttcgcaa cggctggggt gtgaagaaag atccggcagc cgcgcgacag       900
     tacttcgaga cggctgctaa cctgggcgac acggatgcca tgaacgaagt tgcttggtgc       960
     tacctggaag gattcggagg taaaaaggac aaatttatgg ctgcgaaata ctaccgactg      1020
     gctgagagta aaggaaacaa gatcgtggga aattcttgta aatccgccca tctccaacct      1080
     ctctccaaaa ccggcactcg tcatctaggc gccccagcac agccctatca tgccccacag      1140
     ccctatcatg ctcccggctc tcgtacagat gggtga                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page