(data stored in ACNUC16935 zone)

EMBL: BN001307.PE38

BN001307.PE38        Location/Qualifiers
FT   CDS_pept        complement(join(107206..107450,107501..107937,
FT                   108031..108194))
FT                   /locus_tag="ANIA_09024"
FT                   /old_locus_tag="AN9024.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007829"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007829"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007829"
FT                   /db_xref="GOA:Q5ARQ6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARQ6"
FT                   /protein_id="CBF84439.1"
FT                   /translation="MNIYATGFSRQKFILCTTRGTTEFRNHRDPLMAPFDKIKPYSELK
FT                   LNSDGEISERYGFPHLGHPSQKYSLSWKTDQAGGGWLSLGNYFGFSTVFIKKREVVKPR
FT                   TGFPKLQRAFHENLVGLIEAFQDGADIYLAYNYHGFAVSLSQVCSTPGIRLAESDLASI
FT                   CRSVLKGLEYIHETLLVAHGNVDSNNTLLCHDGAVKIANIGDSMMDVGHQRSFALDREN
FT                   VGSLLVQLSIAHMTELPPRNQGSNLGAYINLSKYAEHFGFLVLDGSSRKKPRLVGFGPT
FT                   "
     atgaatattt atgcaacagg tttttccagg caaaagttta ttctgtgcac tacacgagga        60
     acaactgagt tcagaaatca tagagatcct ctgatggctc cattcgacaa gatcaaaccc       120
     tattcggagt tgaagttgaa tagtgatgga gagatctctg agaggtatgg gtttcctcac       180
     ctagggcatc cctctcaaaa atattcttta agttggaaga cggaccaggc agggggcggg       240
     tggcttagcc ttggcaacta ctttggattc tcgactgtct tcatcaaaaa aagagaggtt       300
     gtcaagccac gaactggatt cccaaaacta caacgtgcgt tccacgaaaa cctggtgggg       360
     ttgatagagg ccttccagga tggtgccgat atttacctgg catacaacta ccacggtttt       420
     gccgttagcc tctcccaagt ctgttcaact cctgggatta ggctcgctga atccgaccta       480
     gcgagcatct gcaggagtgt actgaagggt ctggagtata tccatgaaac ccttttggtt       540
     gctcatggaa atgtcgacag caacaatact cttctatgtc atgacggagc cgtcaaaata       600
     gccaatattg gagacagcat gatggatgtt ggccaccaaa gaagctttgc tctcgaccgc       660
     gaaaatgttg gttcgctgtt ggtacagctc agtattgcgc acatgactga gcttcccccg       720
     agaaaccagg gcagcaatct cggtgcatac attaatctgt ctaagtacgc agagcacttc       780
     ggcttcttgg tacttgatgg gtcgagccgg aaaaagccgc ggctagttgg tttcgggccg       840
     acttga                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page