(data stored in ACNUC16935 zone)

EMBL: BN001307.PE380

BN001307.PE380       Location/Qualifiers
FT   CDS_pept        complement(join(1047357..1047916,1048010..1048065,
FT                   1048115..1048856,1048908..1048953))
FT                   /locus_tag="ANIA_01537"
FT                   /old_locus_tag="AN1537.4"
FT                   /product="CCCH zinc finger protein (AFU_orthologue;
FT                   AFUA_8G05480)"
FT                   /note="transcript_id=CADANIAT00008164"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008164"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008164"
FT                   /db_xref="GOA:C8VMX4"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMX4"
FT                   /protein_id="CBF85065.1"
FT                   /translation="MSEDQDLMARISQLAGQINRFKNGNTPVQSAHNEMHSNSHVSRHT
FT                   SYRGRPGWAPYRGRPYGRGRGAAPHRHRTLILNNSATPASKSSTPPDGMAIDTDENSRS
FT                   ATPNAWVTKHARHMQLINSAVYDKEAQKRVKALEETRKAKAQKKAQIEQAKVLQFAHGA
FT                   GRQFSSSSNPQVSAAGESHGEYQITLNDIPFRVSRGGGKLIRVSSATPVLSALIERAGL
FT                   QIVDDPNTANNTPKRVKVAGVTFVRSKNGNLHRLGAVTSKRVPSAVKKKDELCQRFTTT
FT                   GTCYKGPSCPYIHDPNKVAICKDFLQTGKCSAGNSCDLSHEPSPHRSPACVHFLRGRCS
FT                   NPECRYAHVRVTPGAPVCRAFATLGYCDKGETCEERHVHECPDYANTGVCKKKHCRLPH
FT                   VDRAGQIRKNAGPKEGEGDDESDASSEEEEFDEIGSDDVDSDYLSDEGELIEGTETGEV
FT                   SKQQDFIRL"
     atgtccgaag atcaggactt aatggccagg atcagtcagc ttgctggcca gatcaacaga        60
     ttcaagaatg gaaatacacc cgttcagtcg gcccataatg aaatgcactc caattcccat       120
     gtctcgcgac atacttccta tcgaggacga cctggttggg ctccttatcg cggacgaccg       180
     tacgggcgcg gtcgtggtgc tgcccctcac cgtcaccgca cccttatcct taacaactct       240
     gcgacgcccg cttccaaaag ctcgactcct ccggacggta tggcgataga tactgacgag       300
     aacagtcgct cggctacacc aaatgcctgg gtgacaaaac acgcgcgaca catgcagctt       360
     atcaactctg cggtttatga taaagaagct cagaagaggg tgaaggcttt ggaagaaacg       420
     cgtaaagcga aagcgcagaa gaaggcgcag atagagcagg caaaagtgct gcaatttgct       480
     cacggcgctg gccgacaatt ttcttcgagc tctaaccccc aggtttctgc ggctggggaa       540
     tctcacggag agtatcagat aactctcaac gacattccat tccgtgtttc tcgcggtggt       600
     ggcaagctga tcagagtttc tagtgcgacc cctgttcttt ccgcgctaat agagagagct       660
     ggcttacaga tagtagatga tccgaacact gcaaacaaca cgcccaagag ggtgaaagtt       720
     gctggggtga cgttcgtccg gagcaagaat ggcaaccttc atcggctggg tgcagtaacc       780
     tctaaaagag tgccctcggc ggtcaagaaa aaggacgagc tttgccaaag attcactacg       840
     acgggtacct gctacaaggg accttcgtgt ccttatatcc acgatccgaa caaagtcgct       900
     atctgcaagg acttccttca gactggcaaa tgtagcgcag gtaacagttg tgatctctcc       960
     catgaaccat cacctcatag gtctcctgct tgtgtgcatt tccttcgagg tcgttgttct      1020
     aacccagagt gtcgctatgc tcatgtccga gtcacacctg gtgcgccagt gtgccgggct      1080
     ttcgcgacgc tgggatactg tgataagggc gagacatgtg aggagagaca tgtgcacgag      1140
     tgccctgact acgccaacac gggtgtatgc aagaagaagc actgccggct gccacatgtt      1200
     gaccgtgcag gacagattcg gaagaatgct ggtcctaaag aaggtgaagg tgacgatgaa      1260
     tcagacgctt ccagtgagga agaagagttt gacgaaattg gctccgatga tgtcgactct      1320
     gattatctct cggatgaggg agaacttata gaaggaacgg aaaccggtga agtctcgaag      1380
     cagcaggatt tcatccggct ttga                                             1404
//

If you have problems or comments...

PBIL Back to PBIL home page