(data stored in ACNUC16935 zone)

EMBL: BN001307.PE381

BN001307.PE381       Location/Qualifiers
FT   CDS_pept        complement(join(1049310..1049690,1049742..1049938,
FT                   1049988..1050252,1050350..1050580))
FT                   /locus_tag="ANIA_01538"
FT                   /old_locus_tag="AN1538.4"
FT                   /product="transcription initiation factor iif, beta subunit
FT                   (AFU_orthologue; AFUA_8G05490)"
FT                   /note="transcript_id=CADANIAT00008165"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008165"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008165"
FT                   /db_xref="GOA:Q5BD42"
FT                   /db_xref="InterPro:IPR003196"
FT                   /db_xref="InterPro:IPR011039"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR040450"
FT                   /db_xref="InterPro:IPR040504"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD42"
FT                   /protein_id="CBF85067.1"
FT                   /translation="MFSHIKQEHDASSPYIKPDPETKDTVLADIDDEDVYEDDGDLDFT
FT                   NADQSLWLSRIPRSLWEHWSKLDDDDEIQIGTVSLRLTESEENRDIPKDYILSRQTLNS
FT                   ENLLHMTQNTYLFTEKDIPGYENRMVTFGEARSALYESMKRDARRKERKKKWEPYIRKT
FT                   IPKRTALVGQVKEEFNCLPVENEEFRILSEKKALEALKPRREVKYVDKMPAKLLQQRHA
FT                   LPGEQGAFVQATKPAKLKAQENKTTRMPQNELLDLIYQCFREYRYWPFKTLKARLRQPE
FT                   AYLKQTLEMIAHLVKSGDFAMTWELKPEARESNYSNAMDVKQEAAPGLDYNFDEGSETD
FT                   AMASGVDNDDTQFENVV"
     atgttttccc atatcaaaca agagcatgat gcctcctcac cttacattaa accggatccc        60
     gagaccaaag acactgttct cgccgacatc gacgatgaag acgtatatga ggatgatggt       120
     gacctagact ttacaaacgc cgaccaaagc ttatggcttt cccgaatacc ccggtcgctc       180
     tgggagcatt ggtccaagct ggatgatgat gatgaaattc agatcggcac agtcagttta       240
     cgcctcaccg aaagcgagga gaaccgcgac attcccaagg actatatttt gtcgcggcag       300
     acgctgaatt cggaaaacct gctacacatg acccagaata catatctctt cacagaaaag       360
     gacattcctg gttacgaaaa tcggatggtc acttttggcg aagcgaggtc tgctttatac       420
     gagtcgatga agcgcgatgc aaggagaaag gagcggaaga agaagtggga gccctatatt       480
     cgcaaaacta ttccgaagcg aactgctttg gtcggacaag tgaaagaaga gttcaactgt       540
     cttcctgtcg aaaacgaaga attcagaatc ctctcagaga agaaggctct ggaagctctg       600
     aagccgagac gagaagttaa atacgttgat aaaatgccgg ccaagttgct tcaacaaagg       660
     cacgctctgc ctggagagca gggcgcgttt gtgcaagcta cgaagccggc caaactcaaa       720
     gcgcaggaaa acaagaccac tcgtatgccg cagaacgagc tgttggatct tatttaccag       780
     tgctttcgcg aatacagata ctggccattt aagacactca aagctaggct tcgccaacct       840
     gaggcttatc ttaagcaaac attggagatg attgcgcacc tagtgaaatc cggcgatttc       900
     gccatgacgt gggagttgaa gcccgaggca agagagagta actactcgaa cgctatggac       960
     gtcaaacaag aagccgcacc cggtttggac tataacttcg atgagggctc ggaaaccgat      1020
     gcgatggcat ccggcgtgga taacgatgat acgcaattcg agaacgtggt ctag            1074
//

If you have problems or comments...

PBIL Back to PBIL home page