(data stored in ACNUC16935 zone)

EMBL: BN001307.PE383

BN001307.PE383       Location/Qualifiers
FT   CDS_pept        complement(join(1053210..1054034,1054087..1054157,
FT                   1054219..1054240))
FT                   /locus_tag="ANIA_01540"
FT                   /old_locus_tag="AN1540.4"
FT                   /product="integral membrane protein (AFU_orthologue;
FT                   AFUA_8G05510)"
FT                   /note="transcript_id=CADANIAT00008167"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008167"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008167"
FT                   /db_xref="GOA:Q5BD40"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD40"
FT                   /protein_id="CBF85071.1"
FT                   /translation="MHIELVLWVVIGGNGSHQADLSEKTMQNFFKIFLANQFTYFALSP
FT                   AIKISIVCFYRRVFAIQTFQWTSFAINTLIALWGAAIFIACGLQCRPLNAYWDHTVVGN
FT                   CFDSNKYIIVNQVFNVLMDFVILALPIPMIWNLQRSWQDKLALNGVFAVGGVVCLASIY
FT                   RIVVLFWINPADITYTVYEATLWTHIEPSIGLICACLPIIRGLFPQFKLSAGRVDNATY
FT                   YGRTYQTTTSTSHTPLSPSLKSPLSEKFFAHQLEEIRSNKAPSLPATPHDNSEFYQGSL
FT                   SPFAIEVRTDIDVENSGQSVRSYK"
     atgcatatcg agctcgtgct gtgggtggtc atcggtggaa atggctctca tcaggcagac        60
     ttgagcgaga aaaccatgca gaacttcttc aagatcttcc ttgcaaacca gttcacctac       120
     ttcgccctca gtcccgccat caaaatctcc attgtctgtt tctaccgacg cgtcttcgca       180
     atccaaactt ttcaatggac ctcatttgcc ataaataccc taatcgccct ctggggtgcc       240
     gccatcttta tcgcttgtgg cctccaatgc cgccctctaa acgcctactg ggaccacacc       300
     gtcgttggta attgcttcga cagcaacaaa tacattattg tcaaccaagt cttcaacgtc       360
     ctcatggatt tcgtcatcct cgccctccct attcccatga tctggaacct ccagcgctct       420
     tggcaagaca agcttgcgct gaacggcgtt ttcgccgtcg gcggcgtcgt ttgccttgcg       480
     tccatttacc gtatcgtcgt gctcttctgg atcaaccctg ccgacatcac ctataccgtc       540
     tatgaagcaa cgctatggac gcacattgag ccatccatcg gccttatatg cgcttgcctt       600
     cctatcatcc gcggtttgtt tccacaattc aaactgtccg caggccgcgt ggacaacgca       660
     acatactatg gccgaaccta tcagacaacc acgtcgacct ctcatacccc gctctcacca       720
     agtctcaagt caccactctc ggagaagttc tttgcgcacc agcttgagga gattcggagt       780
     aataaggcac cctcgcttcc cgccactcct catgacaatt ccgagtttta ccagggctct       840
     ctaagtccgt ttgctattga ggtccgcaca gacatagatg tggagaatag cggacaatca       900
     gttcgctctt ataagtga                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page