(data stored in ACNUC16935 zone)

EMBL: BN001307.PE384

BN001307.PE384       Location/Qualifiers
FT   CDS_pept        join(1056809..1057266,1057315..1057708,1057759..1058216,
FT                   1058298..1058442)
FT                   /locus_tag="ANIA_01541"
FT                   /old_locus_tag="AN1541.4"
FT                   /product="aldehyde dehydrogenase family protein
FT                   (AFU_orthologue; AFUA_8G05520)"
FT                   /note="transcript_id=CADANIAT00008168"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008168"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008168"
FT                   /db_xref="GOA:Q5BD39"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD39"
FT                   /protein_id="CBF85073.1"
FT                   /translation="MTTPTPSVIPLIINGKEELASSVFDVISPYTNKACWAAASASPQD
FT                   AIRAVEAAQAAFPAWSQTKPTVRRDILLKAADILESRLEKCAEFMRTEMGADAGASQFF
FT                   VVPLAIRMLREVASRITSICGTVPVVEAEGQSAIIYKEPMGVILGIVPWNAPYVFGVRS
FT                   AACALAAGNTTILKSSELTPCCYWALTRAFHDAGLPDGCLNLVSCRPQDAAEVVNAMIE
FT                   HPAVMKINFTGSTAVGRKIARACGQNLKPCLMELGGKNSSIVCADADIETAVKSVIAGA
FT                   YLNSGQICMATDRILVHSSIAPTFVEALKSALQSMSDPSSEPPTLVNVASKARVQRLIE
FT                   SALEAGAHIIHGSVTADSDAANSDSGVRMPPVLLGGVKEDMAVWQDEAFASLAACMTFD
FT                   TEEEAVRIANSSGYGLSAAVFTQDLRKGLAIARKIQSGAVHINSMTIHDEPVLPHGGVK
FT                   NSGWGRFNASQGLEEFLVTKSVTWMD"
     atgacaacac caacgccttc ggttatccct ttgatcatca acggcaagga ggagctggct        60
     tcctcagtgt tcgatgtaat tagtccttac acaaacaagg cctgctgggc cgcagcatct       120
     gcttcacctc aagatgccat tcgtgccgtt gaggcagccc aagcggcgtt cccagcatgg       180
     tcgcagacta agccgactgt ccgacgagat atcctcctca aggcggcaga catccttgag       240
     agtagactgg agaagtgtgc cgagttcatg cggacggaga tgggagcaga tgctggggcg       300
     tcacaattct tcgttgtccc cctggcaatc cgtatgttga gggaagtggc aagccgcatc       360
     acctcaattt gcggcactgt acctgttgtc gaggcggaag gacagagcgc aatcatctat       420
     aaggagccga tgggagttat cctgggaatt gtaccatgga atgcaccgta cgtgttcggt       480
     gttcgatctg ctgcatgtgc tcttgccgcc ggcaatacga cgattctgaa atcgtccgaa       540
     ctcacgccat gctgttactg ggcgctgacc cgcgcctttc acgacgccgg attgccagac       600
     gggtgtctca accttgtgtc ctgtcgcccg caggatgcag cagaggtggt caacgccatg       660
     attgagcacc cggctgtgat gaagattaac tttaccggaa gcacggctgt tggccggaag       720
     atcgctcgtg cttgcgggca gaatcttaag ccgtgcctga tggagctagg gggtaaaaac       780
     agctcaattg tgtgtgctga tgcagatatt gaaaccgctg tcaagtccgt aattgccggg       840
     gcgtatttga actccggcca aatttgcatg gctacagacc ggattcttgt gcattcctcc       900
     attgcaccaa cttttgtgga agctctcaag agtgctttgc agtcaatgtc tgacccctca       960
     tctgagcctc caactctggt caacgttgcg tccaaggcgc gtgtgcagcg gctaatcgag      1020
     agtgctcttg aagctggtgc ccatataatt cacggatccg taactgcaga ctctgacgca      1080
     gcaaactcag attctggagt ccgtatgcca cccgtccttc taggtggagt caaggaggat      1140
     atggccgtat ggcaggatga agcgttcgct tcattagcag cttgcatgac attcgacaca      1200
     gaggaagaag cagtccggat tgcgaatagc agcgggtatg ggctgtccgc ggcggtgttt      1260
     actcaggatc tgcgaaaagg tctggcgatc gccaggaaaa ttcagtctgg cgccgtacat      1320
     atcaacagca tgacgattca cgacgagccc gtactgcctc atggaggcgt taagaacagt      1380
     ggctggggtc gattcaatgc ctctcaaggc ttggaagaat tcttggttac aaaaagtgtg      1440
     acttggatgg actga                                                       1455
//

If you have problems or comments...

PBIL Back to PBIL home page