(data stored in ACNUC16935 zone)

EMBL: BN001307.PE388

BN001307.PE388       Location/Qualifiers
FT   CDS_pept        complement(1066921..1067961)
FT                   /locus_tag="ANIA_01544"
FT                   /old_locus_tag="AN1544.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008172"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008172"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008172"
FT                   /db_xref="GOA:Q5BD36"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD36"
FT                   /protein_id="CBF85080.1"
FT                   /translation="MSDHQKRGSSEDSNTPTKQRPDRNDGDPAQSDQDTQSLASRIQKS
FT                   ASGLARNAFFSSTPSGDTAHLLSDSGKAAPSSSSSALAAAEQYKDTTGPSSSASRDHNV
FT                   HVPAETFRSPGATHSGGFELPRLTEDEFQSTYGGNLSDTIDPLDETKGKGRAINSVPGS
FT                   GLTSSIYHDGTTAPPTLNPSDGDAVVAILNDQTFDPEFPPSANEPPEYVETELSPLQLT
FT                   PEEMQMIESFRRQLPPDSQSTTDTQQKRQLNSFSLVPDIGSFLDTVPAASATDATSLRD
FT                   TVLANLPGAAEWMSVEEEYHDEVWGYLRPTLEAAAKEIESKKDSGITEDGPAVRRLKMI
FT                   LKHMQH"
     atgtccgatc accagaagcg gggtagttct gaggatagca atactccgac gaaacaacga        60
     ccagacagga acgacggcga ccctgcacag tctgaccagg atactcagtc tctagcttca       120
     cgcattcaaa aatcagcctc tgggctcgcg agaaatgctt tcttctcctc tactccctcg       180
     ggagataccg cgcatctact ctcagacagt ggcaaggctg cgccgtcttc atcttcctca       240
     gccttagcag ccgcagagca atacaaagac actaccgggc catcttcgtc ggcttctcgc       300
     gatcacaacg ttcatgtccc cgcggaaaca ttcagatcac cgggcgcgac tcattcggga       360
     ggattcgagc tacctcggct cacggaggac gaattccaga gcacttatgg cgggaatttg       420
     tcggacacaa tcgatcctct cgacgagaca aaagggaaag gcagagctat aaactcagta       480
     cctgggtctg ggcttacatc ctcgatttac cacgatggaa ccaccgcacc gccgactcta       540
     aacccgtccg acggcgacgc tgtagtcgca attctgaatg atcaaacttt cgatccggaa       600
     ttccctccct cagccaacga acctccagaa tatgtcgaga cggagctctc cccacttcag       660
     cttaccccag aggagatgca aatgattgag tcgttccgac gccagttacc acccgactcg       720
     cagtcaacga ctgacacaca gcagaagcga cagcttaact cgttcagtct cgtcccagat       780
     attggctcat tcctggatac ggttcctgct gcgtcggcga cagacgcaac ttcgctgcga       840
     gatactgtct tggcaaatct gcccggtgcg gcggagtgga tgtctgtcga ggaggaatac       900
     cacgatgaag tttggggtta cttacggccc acgctggagg ctgctgctaa ggagattgag       960
     tcaaagaaag attctggcat tactgaggac gggcctgcag ttcgaagatt gaagatgatt      1020
     ctgaagcata tgcagcattg a                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page