(data stored in ACNUC16935 zone)

EMBL: BN001307.PE389

BN001307.PE389       Location/Qualifiers
FT   CDS_pept        join(1069203..1069246,1069417..1069457,1069523..1069620,
FT                   1069680..1070325,1070395..1070960,1071020..1071043)
FT                   /locus_tag="ANIA_01545"
FT                   /old_locus_tag="AN1545.4"
FT                   /product="hypothetical protein similar to protein
FT                   phosphatase 2A regulatory B subunit (Broad)"
FT                   /note="transcript_id=CADANIAT00008173"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008173"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008173"
FT                   /db_xref="GOA:C8VMY3"
FT                   /db_xref="InterPro:IPR000009"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR018067"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMY3"
FT                   /protein_id="CBF85082.1"
FT                   /translation="MVDRDPGTPTWKFTQCFGDKGDVEDITEADIISTVEFDHTGNYLA
FT                   TGDKGGRVVLFERNETKKTCEYKFHTEFQSHEPEFDYLKSLEIEEKINKIKWCRRQNAS
FT                   HFLLSTNDKTIKLWKVFDKSLKVVAENNLSTELTPGGVGGGGAPRAPRVSFKDSSALKL
FT                   PRMTHHDTVVAAVPRRTYANAHAYHINSISVNSDGETFISSDDLRVNLWNLNIQDQSFN
FT                   IVDIKPANMEELTEVITAAEFHPTSCNWFMYASSKGTIKLADMRQRALCDTHHKLFEQE
FT                   EDASSRSFFSEIISSISDVRFSHDGRYIVSRDYLTVKIWDVNMERQPVKTIPIHEHLRP
FT                   RLCDTYENDSIFDKFEVVFSGDAENVMTGSYNNNFMIYPTDPAKETEIVLQADKSAFKA
FT                   KKVGVPTPMNKGANGKKSNSRTSSPAGPGSRMKKETDADQIDFNKKILHMSWHPFEDSI
FT                   AIAATNNLFVFSAL"
     atggtggaca gggacccagg tacacctacc tggaaattca cacaatgctt tggcgataaa        60
     ggcgatgtag aagacattac agaagccgat attatttcta ctgtcgagtt cgaccatacc       120
     ggtaattacc tcgccacagg agacaagggc ggaagagtgg tgctctttga aaggaacgaa       180
     acaaagaaaa catgcgaata caaattccat accgaattcc agtcacatga gccagaattc       240
     gactacctaa aatccctaga gatcgaagag aaaatcaaca aaataaaatg gtgccggcgc       300
     caaaatgcgt cacatttcct actttcgact aatgacaaaa caatcaagct gtggaaggtg       360
     tttgataaat ctctcaaagt cgttgcggag aacaatctct ctacagagct tacccctggc       420
     ggcgttggtg gtggaggggc acccagagcg cctcgagtgt cttttaaaga ttcctcagca       480
     ctgaagcttc cacgaatgac acatcacgac actgtcgtcg cagctgtacc tagacgaaca       540
     tacgctaacg cccatgcata ccacattaac agcatctctg tcaacagtga cggggagacg       600
     ttcattagca gtgacgatct gcgagtcaac ctctggaact tgaatattca agaccagagc       660
     ttcaacattg tcgacatcaa accagcaaac atggaagagc ttacagaagt catcaccgcc       720
     gcagagtttc atcctacaag ctgtaactgg ttcatgtacg cgagctcaaa ggggaccatc       780
     aagcttgccg acatgcgaca acgggctctt tgtgataccc accacaagct gtttgagcaa       840
     gaagaagacg cctcttcccg ttctttcttc tccgaaatca tttcctcgat atctgacgta       900
     agattctctc acgatggccg gtacattgta tcacgagatt acctcaccgt caagatttgg       960
     gacgtcaaca tggagcgaca acccgtgaag acaatcccca ttcatgaaca tctccgacct      1020
     cgtctatgcg atacgtacga gaacgacagc atctttgata aattcgaggt ggtcttttcg      1080
     ggcgatgcag agaacgttat gacaggcagt tacaacaata atttcatgat ttatcctacc      1140
     gatcccgcga aggaaaccga gattgttttg caggctgaca agtctgcgtt caaggcgaag      1200
     aaggtcggcg taccaacgcc gatgaataag ggtgccaatg ggaagaagag taactcaagg      1260
     accagcagcc ctgctggtcc tggcagccgc atgaagaagg agacagatgc agatcaaatt      1320
     gatttcaaca agaagatcct gcacatgagc tggcatccgt ttgaggatag cattgccatt      1380
     gctgccacaa acaacttatt tgtcttctct gctctctag                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page