(data stored in ACNUC16935 zone)

EMBL: BN001307.PE391

BN001307.PE391       Location/Qualifiers
FT   CDS_pept        join(1078912..1079054,1079105..1079345,1079394..1080587)
FT                   /locus_tag="ANIA_01547"
FT                   /old_locus_tag="AN1547.4"
FT                   /product="Acyl-CoA carboxylate CoA-transferasePutative
FT                   uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q5BD33]"
FT                   /note="transcript_id=CADANIAT00008175"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008175"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008175"
FT                   /db_xref="GOA:Q5BD33"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD33"
FT                   /protein_id="CBF85085.1"
FT                   /translation="MSASALLRSRVRRPSYLNKIAKAEDLIDLFPNGSYIGWSGFTGVG
FT                   YPKKVPTALADHVEKNGLEGKLKYTLFVGASSGAETENRWARLNMIDRRSPHQVGKEIA
FT                   KGINNGQIKFFDKHLSMFPSDLTYGWYTLNKPKNRIDVAVIEASAITEDGGIIPGASVG
FT                   ASPELVQMADKVIIEVNTASPSFEGLHDITMSELPPNRKPYLILQPEDRIGTPHIPVDP
FT                   EKVVAIVESDYPDQTQPNSPEDANSQAIASNLIEFLKHEVKHGRLPPNLLPIQSGIGNI
FT                   ANAVIGGLSKGGADFTNLKVWTEVLQDSFLDLFDSGNLDFATATSIRFSPDGFKRFYDN
FT                   WERYAGKLLLRSQQVSNSPEIIRRLGCIGMNTPVEVDIYAHANSTCVMGSRMLNGLGGS
FT                   ADFLRSSKYSIMHTPSVRPSKTDPTGVSCIVPFATHIDQTEHDLDVIVTEQGLADVRGL
FT                   SPRERARVIIKKCSHPDYTPILTDYLDRAEFECLKKGMAHEPHLLFNAFKMHKNLQENG
FT                   TMKISNWD"
     atgtcggctt ccgccctgct caggagccgt gtccgacggc cctcgtacct taacaagatc        60
     gccaaggctg aggaccttat tgatctcttc cccaatggct cgtatatcgg ctggtccggt       120
     ttcacaggtg ttgggtatcc gaagaaagtc cccacggcgc tggctgacca cgtcgagaag       180
     aatggccttg agggcaagct caagtacaca ctcttcgtcg gagcttcatc tggtgcagag       240
     actgaaaacc gctgggcgag actgaacatg atcgaccgcc gaagccctca ccaggtcggc       300
     aaggagattg ccaagggtat caacaacggt cagatcaaat tctttgataa gcatctcagc       360
     atgttcccgt ccgatcttac ctacggctgg tacacactga acaagcctaa aaaccgtatt       420
     gatgttgctg tcatcgaagc ctccgccatc acagaggacg gtggtatcat tcctggagct       480
     tcagtcggcg catcgcccga gctcgtgcag atggcggaca aggtcattat tgaggtcaac       540
     accgccagcc cttccttcga gggtctgcac gacattacca tgtccgagct ccccccgaac       600
     cgcaagcctt acctgatcct ccagcccgaa gaccgtatcg gtacccctca catccccgtc       660
     gaccctgaga aggtcgttgc cattgtcgaa tccgactacc ctgaccagac tcagcccaac       720
     tctcctgaag acgccaactc ccaggccatc gcctccaacc tcattgaatt cctgaagcat       780
     gaagtcaagc atggccgtct cccccccaac cttcttccca tccaatccgg tattggaaac       840
     attgccaacg ccgtcattgg cggcctcagc aagggtggcg cagactttac caacctcaag       900
     gtatggaccg aggtcctcca agactctttc ctcgacctct tcgacagcgg caacctcgac       960
     ttcgcgacgg cgacttccat ccgcttctcc cccgatggct tcaagcgctt ctacgacaac      1020
     tgggagcgct atgctggcaa gcttctcctg cgctctcaac aggtttccaa ctctcctgag      1080
     atcatccgtc gtctgggctg catcggcatg aacactcccg ttgaagtcga catctacgcc      1140
     cacgctaaca gcacgtgcgt catgggctcg cgcatgctca acggtctcgg cggctctgcc      1200
     gatttcctgc gttcttccaa gtacagtatc atgcacaccc ctagtgtccg gccctccaag      1260
     acagacccca ccggtgtctc ctgcatcgtt cccttcgcta cacacattga ccagaccgag      1320
     cacgatctcg atgtgattgt tacagagcaa ggtcttgctg atgtgcgtgg cttgagtccc      1380
     cgtgagcgtg cacgtgtcat tatcaagaag tgctctcacc ccgactacac accaatcctg      1440
     acagattacc tggaccgtgc tgagttcgag tgcttgaaga agggcatggc tcacgagccc      1500
     cacctgctct tcaacgcgtt caagatgcac aagaacctcc aggagaacgg aacgatgaag      1560
     atttctaact gggactaa                                                    1578
//

If you have problems or comments...

PBIL Back to PBIL home page