(data stored in ACNUC16935 zone)

EMBL: BN001307.PE394

BN001307.PE394       Location/Qualifiers
FT   CDS_pept        complement(join(1085398..1085944,1086031..1087380,
FT                   1087578..1087594))
FT                   /locus_tag="ANIA_01550"
FT                   /old_locus_tag="AN1550.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008178"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008178"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008178"
FT                   /db_xref="GOA:Q5BD30"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD30"
FT                   /protein_id="CBF85091.1"
FT                   /translation="MIACCRPFIDKGTLERRNGIHWRMPAAMAVCWIIGLGLALGHHFY
FT                   YFSLDGTIVPGQTQQEWSLRVGTGLAFLTKTFLTTSVGIACVQNIWWILRMKPVRLSTL
FT                   DSMWDIRGNIFNFFDLHIWLRGPNVAILGLISWCVVLVYVVSSLLKCLRCIPLVTVVTP
FT                   STLSVRSTIGSMLQEQQMPAIDFNFDKFYTMDDGGPTGPTPSVTRFITGAVIQGTIPSI
FT                   PAPAPNSSYSLTFPGPLIQCSNSSANVSQQVYDWAHANYAHSTSFMGFMSETDNISHAM
FT                   NQLVYEPYQGPDNGDRDADVAGKLIMTVSPYMPLDKRWVVECGIYNASYSVDFNFTNGV
FT                   QSTRITDLQILGRVRDHRQHEIPPPANEDQLFAYTAMMRVFRDVLIGRCVQSGSICTDT
FT                   KIYSSALVNSKQIWQLVYNDKKKVGNTTYDSLGSILDVASELGRNITLSFFGSPYFLNT
FT                   SIGPLVNVTTHPSQTEYVYSQRNLLLAYGLSVFTSLLCIIAGLLTMWDNGIAFLDSPTT
FT                   ILRATRNPMFDEIVPTDSTTGADPTPESLSNTRVLWVQSASPGSNHTVAGLKPLPNTAE
FT                   PEKTGNDNRTANAGSETGLQAMTPITFSNGIPGWERKRYRPTISMVETETREASPPPGG
FT                   FI"
     atgattgcat gttgcaggcc attcatagac aagggcacac ttgaaagaag aaatggcatc        60
     cattggagaa tgccagcggc tatggccgta tgttggatta taggactagg gctggcgctt       120
     ggtcaccatt tttactactt ctccttggat ggcaccatcg ttcccggaca aactcagcag       180
     gaatggtcct tgagagtagg caccggactc gcctttttaa cgaagacgtt tttgactaca       240
     agcgtcggta tcgcctgcgt ccagaatatc tggtggatct tacgaatgaa accggtgagg       300
     ctgtcaactc tagattcaat gtgggatatc cggggcaaca tcttcaactt cttcgacctc       360
     catatatggc ttcgaggtcc taatgtggct atactggggc taatctcgtg gtgcgtggtc       420
     cttgtctatg tggtctcaag cctgctaaag tgcctcaggt gtattcccct ggtcactgtt       480
     gtgacccctt caacgctatc agttcgttct acaatagggt ctatgttaca agaacaacaa       540
     atgccagcca ttgattttaa cttcgacaaa ttctacacca tggacgatgg gggcccgacg       600
     ggtccaacac cgagcgtcac ccgcttcata accggagccg tcatccaagg aacgattccc       660
     agcattccag caccagcgcc aaactcgtca tattcactga ccttccctgg cccgctaatc       720
     caatgcagta actccagtgc caatgtgagc cagcaagtat acgactgggc acatgccaac       780
     tacgcccact ccacgtcttt catgggcttc atgtccgaga cagataacat atctcatgcc       840
     atgaaccagc tagtctacga gccctaccaa ggtcctgata acggagatag ggacgctgat       900
     gtggctggca aattgataat gaccgtctcg ccatatatgc ctctggataa gcgatgggtg       960
     gtagaatgtg gtatatacaa cgcctcgtat tcagtggact tcaacttcac caacggcgtt      1020
     caatcaacta ggatcactga tctccagatt ctgggtcgtg tgcgggatca cagacaacac      1080
     gagatacccc cccccgcgaa cgaagaccag cttttcgctt acacggccat gatgagggtg      1140
     tttcgagatg tgttgatagg aagatgcgtt caaagcggct caatctgcac cgacacaaaa      1200
     atttattcct ccgcgctagt caattccaaa caaatctggc agctggttta taacgataaa      1260
     aagaaagtcg gcaatacgac ttacgactcc ctaggctcaa tcctagacgt tgcctcggag      1320
     ttagggcgga atatcaccct aagcttcttt ggcagtccct atttcctaaa cacgtccatt      1380
     ggccccctcg tcaacgtaac tacccaccca agccaaaccg aatatgttta ctcccagcgc      1440
     aatctactcc tcgcctacgg cctctccgtc ttcacctctc tcctctgcat aatcgcaggt      1500
     ctgctcacga tgtgggataa tggaatcgcc ttcctcgact cccccaccac aatcctccgc      1560
     gcaacgcgaa atccaatgtt cgacgagatc gtgccgacag attccacgac aggcgcggat      1620
     ccaacgcccg agtcattgtc caatactcgg gtgctttggg tgcagtcagc tagtcctggg      1680
     tctaatcata cagttgctgg tttgaaaccg ctgccaaaca cggcggagcc ggagaagaca      1740
     ggaaatgaca ataggactgc aaatgcgggc tccgagactg gtttgcaggc gatgactccc      1800
     atcaccttta gcaacggtat tccgggttgg gagaggaagc ggtaccggcc aactatctca      1860
     atggttgaaa ccgagacaag ggaagcgtca ccaccgcccg gtgggtttat ataa            1914
//

If you have problems or comments...

PBIL Back to PBIL home page