(data stored in ACNUC16935 zone)

EMBL: BN001307.PE395

BN001307.PE395       Location/Qualifiers
FT   CDS_pept        complement(join(1088639..1090125,1090182..1090362))
FT                   /locus_tag="ANIA_01551"
FT                   /old_locus_tag="AN1551.4"
FT                   /product="Putative beta-glucosidasePutative uncharacterized
FT                   protein ; [Source:UniProtKB/TrEMBL;Acc:Q5BD29]"
FT                   /note="transcript_id=CADANIAT00008179"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008179"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008179"
FT                   /db_xref="GOA:Q5BD29"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5BD29"
FT                   /protein_id="CBF85093.1"
FT                   /translation="MRGAILATAAAFAGTAVADMHMRRHAHEGLHHRALHASSAVPEEE
FT                   CGCTTEVITYWGEPTTIPLSVPTSTVTSETTETVHSTSYSTVTVTATSSAAPVETPSET
FT                   PSPTPEVTLPTAGVTSYSETGTYTIPATTITVTDTTTVCGATTTELPSGTHTYGGVTTI
FT                   VETATTITCPYATVKPTGSTVTSVIETTTYVCPSAGTYTIAPTTTFVPTSTVVVYPTPE
FT                   TVTPGTYTNPGTTITVTRTEDVYVCPYTNGNVPTSVPALPTTSAASTTTAVPSSSTTTS
FT                   SATSVPTGASGNKMGMTFTPYNNDGSCMAKNDVLEQVGLIKGKGFSHVRVYGTDCHTLE
FT                   YVGAACSTHGLKMILGVNVEGSTGFDGARSQFKDITNWGQWDLVSLIVVGNEVVTSNIA
FT                   SAAQLASFVSEGASAFSAAGYTGQVTTAEPIDVWLSNGATLCPVVDILGANLHPFFNPE
FT                   FTAAEAGTLVSNQIKDLKQVCTGKDVINLETGWPNAGSANGKAIPGQSQQTTAIKSLVE
FT                   KVGDVSVFFSYADDGWKSKFATSDKYNVEQHWGCIDQF"
     atgaggggag ctatcctggc caccgcggcc gccttcgccg gcaccgccgt tgcggacatg        60
     cacatgcgcc gccatgccca cgagggtctt caccaccgtg ccctccacgc ctcttccgct       120
     gttcccgagg aggagtgcgg ctgcaccacc gaggtcatca cctactgggg cgagcctaca       180
     actatccccc tctcggttcc taccagcacc gtgacctctg agaccaccga gactgttcac       240
     tctaccagct acagcaccgt cacggtcact gcgacttcct ctgccgctcc ggtcgagact       300
     ccttccgaga ctccctctcc aacccccgag gtcactctcc ccaccgccgg cgtgaccagc       360
     tactcggaga ctggtaccta caccatccct gctaccacca tcaccgtcac cgataccacc       420
     actgtctgcg gcgctactac cactgagctc cccagcggta cccacaccta cggtggtgtc       480
     accaccattg tcgagaccgc cacgaccatc acctgcccct atgccaccgt caagcccact       540
     ggcagcaccg tcaccagcgt catcgagacc acgacctacg tctgcccctc ggctggtacc       600
     tacaccattg ccccgaccac caccttcgtc cctacctcca ccgtcgttgt ctaccccacc       660
     ccggaaaccg tcacccctgg cacctacacc aaccctggta ccaccatcac cgtgactcgc       720
     actgaggacg tctatgtctg cccttacacc aacggcaatg tccccaccag cgtccctgcc       780
     ctgcccacca cctctgctgc ctcgaccact actgctgttc ccagcagcag caccaccacc       840
     tcgtctgcca ccagcgtccc caccggtgct agcggaaaca agatgggtat gactttcacc       900
     ccctacaaca acgacggaag ctgcatggcc aagaacgatg ttcttgagca ggttggtctt       960
     atcaagggga agggattctc ccacgttcgt gtttacggaa ccgactgcca caccctcgag      1020
     tacgttggag ctgcttgcag cacccacggc ctcaagatga tcctcggtgt caatgtcgag      1080
     ggctccaccg gttttgatgg tgctcgttcc cagttcaagg acattaccaa ctggggccag      1140
     tgggatcttg tctctctcat tgttgtcggt aacgaagtcg tcactagcaa catcgcgtcc      1200
     gctgcccagc tcgccagctt cgtctccgag ggcgccagcg ctttctctgc cgccggctac      1260
     actggccagg ttaccaccgc tgagcctatc gacgtctggc tcagtaacgg tgctactctc      1320
     tgccctgtcg ttgatatcct gggtgcgaac cttcacccct tcttcaaccc cgagttcacc      1380
     gccgctgagg ccggtactct cgtcagcaac cagatcaagg atctgaagca ggtctgcact      1440
     ggcaaggacg tcattaacct cgagaccggc tggcccaacg ccggtagtgc taacggcaag      1500
     gctattcccg gtcagtccca gcaaaccact gccatcaagt ccctcgtcga gaaggttggc      1560
     gatgtttccg ttttcttctc ctacgccgat gacggctgga agtctaagtt cgctaccagc      1620
     gacaaataca atgttgagca gcactgggga tgcatcgacc aattttaa                   1668
//

If you have problems or comments...

PBIL Back to PBIL home page