(data stored in ACNUC16935 zone)

EMBL: BN001307.PE396

BN001307.PE396       Location/Qualifiers
FT   CDS_pept        join(1093857..1093995,1094065..1094080,1094126..1094477)
FT                   /locus_tag="ANIA_01552"
FT                   /old_locus_tag="AN1552.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008180"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008180"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008180"
FT                   /db_xref="GOA:Q5BD28"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD28"
FT                   /protein_id="CBF85095.1"
FT                   /translation="MTRSELCPTFIPLFLPRIAAHYNQPDGFRLQTSTLVREFDQEKGA
FT                   AGDSAWKLASIHPAGIRLIMRLIHLRFQSYRARIVQPHMDSALPPVNQLYDFNMPRQNR
FT                   EKLSVLCYMASEPMEDTEWPRLRTATAISSPKEVGEESTNTTGKRCKPPSQVRKRNNAP
FT                   EEALS"
     atgaccagat ctgagctctg tcccaccttt atccctcttt ttctccctag gatagccgct        60
     cattataatc agcccgacgg attcagactg caaacaagca ctctcgtcag agaatttgac       120
     caggaaaagg gggctgcagg ggactcggct tggaaacttg ctagcattca tcccgccggc       180
     attcgcctca ttatgaggtt aatccatctc cgctttcaat cataccgcgc tcgcatcgta       240
     caaccgcaca tggattcggc cttaccaccc gtgaaccagc tgtatgactt caatatgcca       300
     agacagaaca gagagaagct ctctgttctc tgctatatgg ccagcgaacc gatggaggat       360
     actgaatggc ctagactccg caccgcaacc gcaatcagta gcccaaagga ggtaggtgag       420
     gaaagcacga acacaacagg caagcgctgc aaaccaccta gtcaagtgcg aaagcgcaat       480
     aacgcacctg aagaggcctt gtcatag                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page