(data stored in ACNUC16935 zone)

EMBL: BN001307.PE397

BN001307.PE397       Location/Qualifiers
FT   CDS_pept        complement(join(1095953..1095980,1096047..1096429))
FT                   /locus_tag="ANIA_01553"
FT                   /old_locus_tag="AN1553.4"
FT                   /product="Asp hemolysin-like protein (AFU_orthologue;
FT                   AFUA_4G02805)"
FT                   /note="transcript_id=CADANIAT00008181"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008181"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008181"
FT                   /db_xref="GOA:Q5BD27"
FT                   /db_xref="InterPro:IPR009413"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD27"
FT                   /protein_id="CBF85097.1"
FT                   /translation="MTIPAEGLGEVCATGRRGSEGWLDLFDGDKKICELHWDNRAERRW
FT                   NDFEVLEPDEGYRVECSGWSSERGPLGHVFVDVSEARKEELRREKELGGLRVFEGPGVG
FT                   EKSVDVDVAEEVPVLGGLGGIGGNITMGGFIS"
     atgaccattc ccgccgaagg cctcggcgag gtttgcgcca ccggtcgccg cggcagtgaa        60
     ggctggcttg atctgtttga cggcgacaag aagatatgcg aactacactg ggataaccgt       120
     gccgagcggc gctggaatga ctttgaagtg ctggagccgg atgagggcta tcgagttgag       180
     tgttcggggt ggagtagcga gaggggtccg cttggccatg tctttgtgga tgtgagtgaa       240
     gcacggaagg aggaattgcg cagggagaag gagcttggcg ggctgagggt ctttgagggc       300
     cctggggtcg gcgagaagag tgtggacgtg gatgtggcgg aggaggttcc tgtgttgggg       360
     gggttggggg ggatcggtgg gaatatcacg atgggtggtt ttatatcata g                411
//

If you have problems or comments...

PBIL Back to PBIL home page