(data stored in ACNUC16935 zone)

EMBL: BN001307.PE4

BN001307.PE4         Location/Qualifiers
FT   CDS_pept        complement(join(10711..11238,11379..11489))
FT                   /locus_tag="ANIA_09508"
FT                   /old_locus_tag="AN9508.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007796"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007796"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007796"
FT                   /db_xref="GOA:Q5AQC2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQC2"
FT                   /protein_id="CBF84377.1"
FT                   /translation="MHSMPVVFAAQNPSAVKELHATIQCGVRPKGAGANKKSNNPAYYG
FT                   TKYPWVNEADGLNQDAVHDGFHLSSYLITAKYLFFDTEEGATALNLTTLPSDNQCSQAS
FT                   GFVFPPLVSTLDIPRDFPDHSSLPSTCAQFASLTLISATEVSPCRVNISPESERAFWPT
FT                   ECHNTLLPVSGCLDRTTKDDITGRDHGRAAWAAITLTFALIFGLGLVGY"
     atgcactcga tgccagtggt attcgctgcc cagaacccct ctgctgtcaa ggagctccac        60
     gcaaccatcc aatgtggggt gcgcccaaaa ggtgctggtg ctaacaagaa atcgaataac       120
     ccagcgtact acggcaccaa gtatccgtgg gttaatgaag ccgacggcct caatcaggac       180
     gccgttcatg atggcttcca cttgtcaagc tacttgatca ctgccaaata cctcttcttc       240
     gacaccgagg aaggtgccac tgccttgaac ctgaccaccc tccccagtga caaccaatgc       300
     agtcaagcct cagggtttgt cttcccgccc ttggtaagca ctctggacat tcccagggac       360
     ttccctgatc acagtagcct gccgtccacg tgcgctcagt tcgccagttt gaccttgatt       420
     tcagccacag aagtgagccc ttgcagagtt aacattagtc ccgaatctga gcgagcattc       480
     tggccgactg aatgccataa cacactcctc cctgtatcag gttgtctgga caggaccaca       540
     aaggacgaca taacaggccg tgaccacggc cgggcagcat gggcagccat tactctaact       600
     tttgccctga ttttcggcct cggcctcgtg gggtactag                              639
//

If you have problems or comments...

PBIL Back to PBIL home page