(data stored in ACNUC16935 zone)

EMBL: BN001307.PE40

BN001307.PE40        Location/Qualifiers
FT   CDS_pept        complement(join(110677..110940,110963..111177,
FT                   111243..111270))
FT                   /locus_tag="ANIA_09022"
FT                   /old_locus_tag="AN9022.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007831"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007831"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007831"
FT                   /db_xref="UniProtKB/TrEMBL:C8VKX8"
FT                   /protein_id="CBF84443.1"
FT                   /translation="MNTNGVVKIGCLEKCVLRDQNESHKAELVSVGNITMELLQKYVKN
FT                   EGRVGIDKLDRWSSDSVAVSFLSATTSANSIKTLMEENGALTYVSLQASPNKQNAFLQG
FT                   GTNRPRVVCTPFDENILVLCPTGKRETASFVSCWIKLLLRLSRSRICESCTSSKDSDIH
FT                   RSTRD"
     atgaacacta atggcgttgt caaaatcgga tgcctagaga aatgtgttct aagggatcaa        60
     aatgaatccc ataaagctga actcgtttct gtcgggaata tcacaatgga gctgttgcag       120
     aagtatgtca aaaacgaagg cagagtcggt attgacaaac tcgatcgctg gtcttcggat       180
     tccgtcgccg ttagtttcct ttcagccaca acttccgcca actctataaa aactctcatg       240
     gaggaaaatg gtgcactcac atacgtttcg cttcaagcat cacctaataa gcaaaatgca       300
     tttctgcaag gaggaactaa tcggcctcgc gtggtttgca ctccattcga cgagaacatt       360
     ttggtcttat gtcccaccgg caaaagagaa acggctagct tcgtgagctg ctggattaaa       420
     ttgttacttc gtttgtctcg ctctcgtata tgcgaatcat gtacatcatc caaggattcg       480
     gacatacatc gttcaactcg cgattaa                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page