(data stored in ACNUC16935 zone)

EMBL: BN001307.PE400

BN001307.PE400       Location/Qualifiers
FT   CDS_pept        join(1109056..1109884,1109936..1111380)
FT                   /locus_tag="ANIA_10216"
FT                   /old_locus_tag="AN10216.4"
FT                   /product="WD repeat protein (AFU_orthologue; AFUA_8G05640)"
FT                   /note="transcript_id=CADANIAT00008184"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008184"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008184"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMZ4"
FT                   /protein_id="CBF85102.1"
FT                   /translation="MAPDDDAHPAGAHAANLPEQRLERPVDGLDSIATSLQDPYSDEAL
FT                   SAFMSVPHYPEATSHRTSIPVSEIVNAVIEPGDFFRRQSTSSQRISGSQISPPMELYVS
FT                   DSEMTDTLSEVGGVPLDEYHIEQMRLAEFASRFVHEAIAQNNHAAVSETTEEASATDSV
FT                   MQYELHTSGQEPISFSTAEDDDDTRKFYLDYGDDDYETNSQSSSSGDGHSHVSNVDLDD
FT                   FYRPPGYTYGSQMSGFDPASSHEDHTNFFSDAEDANTDPAADPHFAESVIHHGTTQERN
FT                   YDIDQFISQWLYQSSTASIPMLSLSPQVFLQSTLSNIMRWQPPAKITRPSGYTGDFYDI
FT                   QQIPWWERLRVRRADARRLRDQTYESYQNLPQYSQRRTGRRLPEEEFYFQGKSMYTAHK
FT                   ATIEHFQLRNLMSVPAYNTVHFAHESKLYSWVPAYDDLQCLIDLSVPNAESGFQGPVKI
FT                   STMKTAVGVSIAGGFFGEYAVRAMGTETKGVEGYVTKDPNGITNHIDIIPSRTNRSPIG
FT                   IFASNDRHVRTLDCETNTFLTDHELTHAVNCTSTSPDGRLRIVVGDSPDAWVVEAETGR
FT                   PVYPLRGHKDFGFACAWSPDMMQVATSNQDKSAIIWDARTWRMLEKIESDVAGYRSLRF
FT                   SPVGGGPRTLLLCEPADRIVIVNAQTYRSRQVHDFFGEVGGADYSPDGSTIWAANTDER
FT                   FGGFMEYDRRQWGQQYGLQQSPNEWVKEADLDEDERCILSERERQSRHLWNLCDEGHEE
FT                   LLLC"
     atggcgccgg atgatgatgc gcatcctgcg ggcgcccatg cggccaacct gccagagcag        60
     cgtttagagc ggcctgtgga tgggttggat tccatcgcga cctctcttca agacccctat       120
     tccgatgagg cgctctccgc tttcatgtcg gtacctcatt atccggaggc aaccagtcac       180
     aggacgagca ttccagtgtc cgaaatcgtt aatgcggtta ttgaaccagg agacttcttt       240
     cgtcgccaga gcacgtctag ccagagaatt tcaggatccc agatctctcc gccaatggaa       300
     ctgtatgtgt ccgattcgga gatgactgat acactgtcgg aggtgggcgg cgtgcctcta       360
     gacgaatatc acatagaaca aatgaggctg gccgagtttg ccagccggtt cgtccatgag       420
     gcgattgctc agaacaacca cgccgcagtg tcagaaacaa ccgaagaagc cagcgcaacg       480
     gattcggtga tgcaatacga gcttcatacg tctgggcaag agccaatatc attctcaacg       540
     gcggaggacg acgatgacac gcggaagttc tacctggact atggcgatga tgactacgag       600
     accaattccc agtcttcctc tagcggtgac ggccactcgc atgtttcaaa cgtcgatttg       660
     gacgattttt atcgaccgcc gggttacacg tatggctccc aaatgtctgg attcgaccct       720
     gcttccagcc atgaggatca taccaacttc ttttccgacg ccgaggacgc aaatactgac       780
     ccagccgcgg accctcactt tgcagagtcc gtcatacatc atggaaccac ccaagagaga       840
     aactatgata ttgaccagtt tatttcgcaa tggctctacc aatcgtctac tgcgtcgata       900
     ccaatgctgt cactatcgcc gcaggtattt cttcagagta ctttatccaa catcatgcga       960
     tggcagccac cggcgaagat cacgcggccg agcggttata ctggagactt ctacgacatc      1020
     caacagatcc cctggtggga gaggttgcgg gtgaggcgag ctgatgcgcg ccggttgcga      1080
     gaccagacgt atgaatcgta ccaaaatctt ccacaataca gccagcgacg gacagggagg      1140
     aggctgcctg aggaagagtt ttatttccag ggaaaatcga tgtacacggc tcacaaagcc      1200
     acgatcgaac acttccagct ccgcaacctg atgtccgttc ccgcgtacaa cactgtacac      1260
     tttgcgcacg aatccaagtt gtattcgtgg gttccggcat atgacgactt gcaatgtctg      1320
     atcgacctgt ccgtacctaa tgctgagtcc ggttttcagg gcccggtcaa gatttcgacc      1380
     atgaaaacgg ctgtaggtgt atctattgcc ggcggcttct tcggagaata tgccgtgcgg      1440
     gctatgggga ctgaaaccaa gggagtggaa ggatacgtta caaaagaccc caacggaatc      1500
     accaaccaca tcgatatcat cccaagtcgc acgaatcggt cgccaatcgg gatttttgct      1560
     tctaatgatc gccatgtgcg gacactagat tgcgaaacta acacctttct tactgatcat      1620
     gaactcacgc atgcggtcaa ctgtacatct acttcacctg atggtcggct ccgtatcgtt      1680
     gtcggcgact cccccgatgc ctgggtcgtt gaagcggaga caggccgacc ggtttaccct      1740
     ctgcgtggac ataaggattt cggcttcgcc tgcgcctggt ccccggatat gatgcaggtc      1800
     gccactagca atcaagacaa gtcagcgata atctgggatg cacggacatg gcgcatgctg      1860
     gagaagatcg agtccgacgt agcgggctac cggtctctac gattctctcc agtcggcgga      1920
     ggtccgcgca ccctgctgct ctgcgaaccg gcagaccgga tagtgattgt caatgcacaa      1980
     acataccgat cgcgccaggt ccacgacttc tttggtgaag ttggaggagc agactactcg      2040
     cctgatggaa gcacaatatg ggcagccaac acggacgagc ggtttggtgg gtttatggag      2100
     tacgatcggc ggcagtgggg gcagcagtat ggcttgcagc agtcaccgaa tgaatgggtc      2160
     aaggaggcag atcttgacga agatgagcgc tgtatactca gcgaacgaga acgacagtcg      2220
     aggcacttgt ggaatttatg cgacgagggg cacgaggagt tgctgctgtg ctag            2274
//

If you have problems or comments...

PBIL Back to PBIL home page