(data stored in ACNUC16935 zone)

EMBL: BN001307.PE401

BN001307.PE401       Location/Qualifiers
FT   CDS_pept        join(1111833..1112237,1112324..1112461)
FT                   /locus_tag="ANIA_10219"
FT                   /old_locus_tag="AN10219.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008185"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008185"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008185"
FT                   /db_xref="GOA:C8VMZ5"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMZ5"
FT                   /protein_id="CBF85104.1"
FT                   /translation="MSLQNILVDAVKSHFDKDDDKDDLKPALSHASANASSEDSNLFSQ
FT                   ALSFINQRKSEGVQDDIDEEQAVNAHRRYEQGGNMDSKDFGAGAALQALKMFNSSSGQE
FT                   TGGGKDKNAFIGMAMAQAAKMWEEKAGKGEASGDKQSAINQAAEMAFKMYLKSQMSGSE
FT                   GTGGPGGLMSLASKFLK"
     atgtccttgc aaaacatcct cgtcgacgcc gtcaagtccc acttcgacaa ggacgacgac        60
     aaagacgacc tgaagccagc tctctcccat gcctccgcca acgcttcctc cgaagactcc       120
     aatctcttct cacaagctct ttcctttatc aaccagcgta agtctgaagg tgtccaagat       180
     gacatcgacg aggagcaggc tgtgaacgcc catcgacgct acgagcaagg cggaaacatg       240
     gactcaaagg actttggtgc tggcgcggcg ttgcaggcgc tgaagatgtt caattcaagc       300
     tcaggccagg agacaggtgg tggaaaggat aagaatgcgt tcattgggat ggccatggcg       360
     caagccgcga agatgtggga agagaaggct ggaaaagggg aggctagcgg agacaagcag       420
     tccgctatta accaggcggc ggaaatggcg ttcaagatgt acttgaaaag tcagatgagt       480
     ggaagtgagg gcactggtgg tcccggcggg ctcatgagcc ttgctagcaa gttcttgaaa       540
     tga                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page