(data stored in ACNUC16935 zone)

EMBL: BN001307.PE402

BN001307.PE402       Location/Qualifiers
FT   CDS_pept        join(1113471..1113563,1113623..1114145,1114219..1114232,
FT                   1114281..1114856,1115048..1115488)
FT                   /locus_tag="ANIA_01557"
FT                   /old_locus_tag="AN1557.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008186"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008186"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008186"
FT                   /db_xref="GOA:Q5BD23"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD23"
FT                   /protein_id="CBF85105.1"
FT                   /translation="MFCGCMIGGSLWGTGKHLFELTSEQRTTAMEYWWFCNISYAVSSV
FT                   LAKVSVCIFLLRVMPFPCHRAALYTVTVLAVCSGIPFFVLLVIQCSPVSFWWTRMRGDT
FT                   NGHCGYVDAIAIMLYIFSASSALFDFTVALLPVILVRNLQMNRRTKAAVAGLLGMACVC
FT                   VIPLFLLADVFFGMLRAGKCSASIAIIIRLAFVQTIHDPDYLYGTVQIAIWSCIEVGLS
FT                   ITAGSLATTRPLFRILHNRSSSPYNPFDDPSTPSNDRNKHRRSISWSEPYPSSRSRRTS
FT                   NRILALENDLGFNFGSGRNNSISTSSRRRSRSSKSTSRPSTSRNKRRSGVTTEGRPSSN
FT                   FYEPYIGVEMLKMQSTTDVEGGRTDDTEGSSHPAPGTELLDPTTDPNSSGLGEFAGRPE
FT                   GLQTAASNYTAHLTTAVMRPRRWTSRDGLAEIGSTLAVVWETTPEVKAHCVKECSVQAS
FT                   SLHYFLAGSSESELYRQRPMRSYRAGGECSRFFFLTIGVLVQLDGQKSKVRISSIFSPF
FT                   STFYCIALSQGCRKYADHGRILSTIKATRPY"
     atgttctgcg gttgcatgat cggcgggtct ctctggggaa cagggaagca tctctttgag        60
     ctgacttccg agcaacgaac tactgcaatg gaatactggt ggttctgcaa tatctcatac       120
     gccgtctcct ccgtgcttgc caaagtatcc gtttgcatct ttctcctccg cgtgatgccc       180
     ttcccctgcc atcgggcagc actctatacg gtcacggttc tcgcagtttg cagtggcata       240
     ccattcttcg tcctgttggt catacagtgc tctcctgtct cattctggtg gactcggatg       300
     aggggcgata caaatggaca ctgtggatat gtcgacgcta tagcaataat gttgtacata       360
     ttcagtgctt cgtcggcgct cttcgatttc acagtagctt tgctgcctgt tatcctcgtc       420
     cgcaatctgc agatgaatcg acggactaag gcagctgttg cgggtcttct ggggatggca       480
     tgtgtgtgcg tcattccatt gtttctcctt gctgatgtct tctttggtat gctaagagca       540
     ggcaaatgta gtgcgagcat cgccatcatc attcggttag ctttcgttca gacaatccat       600
     gaccctgact atctttacgg aaccgttcaa attgcaatct ggtcctgcat agaggtcggc       660
     ctttccataa cagcggggtc cctcgcaaca acccgcccct tgtttcgcat cctccacaat       720
     cggtcctctt ccccatacaa ccccttcgac gacccttcga cccctagcaa tgaccgaaac       780
     aagcatcgcc gctccatatc ctggtctgaa ccttatccta gctcccgatc cagacgcacc       840
     tcaaaccgca ttcttgccct tgaaaatgac ctcggcttca actttggttc cggccgaaac       900
     aactcaatct cgacctcgag tcgtcgtcgc tctcgttctt caaagtctac atctcgtccc       960
     agtacaagcc gcaacaaacg ccgcagcggc gtcacaaccg agggccggcc aagctctaac      1020
     ttctatgaac cgtatatcgg cgtagagatg ttgaagatgc agtcgaccac tgacgtggaa      1080
     ggcggccgga cagatgacac tgaagggtcg tcacaccctg ctcctggcac ggaactgttg      1140
     gacccaacta ccgaccctaa ttcttctggt cttggtgaat ttgccggacg gccggagggc      1200
     cttcagacag cagcgtcgaa ctataccgca cacctcacca ccgctgtaat gcgcccacga      1260
     cgttggacgt cacgagatgg attagcggag ataggcagca ctctagctgt ggtctgggag      1320
     actactcctg aagtgaaggc ccattgcgtc aaggagtgca gtgttcaagc cagttcgttg      1380
     cattacttcc ttgcgggcag tagcgagtct gaactttatc gccaacggcc catgaggtcg      1440
     taccgcgcag gcggcgaatg ttcgcgcttt ttttttctca caattggggt cttagtgcaa      1500
     ttggatggcc agaagagcaa ggttaggatc agcagtattt tctccccatt ttccaccttt      1560
     tactgtatag cgctctctca gggctgccgc aagtacgccg accatggtag aattctgtcc      1620
     actattaaag ctactcgacc ttactga                                          1647
//

If you have problems or comments...

PBIL Back to PBIL home page