(data stored in ACNUC16935 zone)

EMBL: BN001307.PE404

BN001307.PE404       Location/Qualifiers
FT   CDS_pept        complement(join(1121947..1122720,1122785..1122844))
FT                   /locus_tag="ANIA_01559"
FT                   /old_locus_tag="AN1559.4"
FT                   /product="OPA3 domain protein (AFU_orthologue;
FT                   AFUA_8G05670)"
FT                   /note="transcript_id=CADANIAT00008188"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008188"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008188"
FT                   /db_xref="GOA:C8VMZ8"
FT                   /db_xref="InterPro:IPR010754"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMZ8"
FT                   /protein_id="CBF85109.1"
FT                   /translation="MSLTLKLSSLVIRTLSKPIANQIKAQAREHERFRRICISMAQGLH
FT                   RLDMRLRLGTIRDNAAATRRAAAEAELRKHKPTSPTVKTEAETRAEEEAIARAKAAASE
FT                   AEKPAPKPHIRPLSESKAIESGATFISETFLFLVAGSLILFESWRSRRKENNRRDDVAA
FT                   RLNELEETVGIYREAFIALEKNGDLPPASRRILLKMIEDVEPEEVPEPEPQGWFTTITS
FT                   YFSFGQSPEKQPEKETDATQPASVAETPKVPSSTPRSGPAASSTTSVPVSKPEKP"
     atgtccctta cgcttaaact ctcttccctc gtcatccgca cgctgtcaaa gccgatagcc        60
     aaccaaataa aagcacaggc tcgcgagcat gagcgatttc ggcgaatttg catctctatg       120
     gcacagggcc tgcatcggct cgacatgcgg ctccgtctcg gcacaattcg cgacaacgct       180
     gcggcaaccc gacgagccgc tgctgaagca gaactccgaa agcataaacc cacatcgcct       240
     actgtgaaga ctgaagctga gacgagggcc gaagaagagg caattgccag ggcgaaggct       300
     gccgcatcgg aggccgaaaa gccggcaccc aaaccacata tacggccact gtccgaatca       360
     aaagccattg aatcaggcgc aactttcatc agcgaaacgt ttctgttcct tgtagcaggc       420
     agtttgatcc tctttgagtc gtggagatca cggagaaagg agaataaccg aagggatgac       480
     gttgcagccc ggctcaacga gctcgaagag actgtaggaa tttaccggga agcatttatt       540
     gctcttgaaa agaacggcga tctacctcca gcctctcgac ggatccttct gaaaatgata       600
     gaggatgtgg aacctgagga agtgcctgaa ccagagccgc agggatggtt cacgacaatc       660
     acctcatact tttcgttcgg ccagagtcca gagaagcagc ctgagaagga aacggatgca       720
     actcagcccg cgagcgtcgc tgagactccc aaagtccctt ccagtacgcc gcgctcagga       780
     ccagcagcta gttcaacgac ctctgttcca gtttcaaaac ccgagaaacc atga             834
//

If you have problems or comments...

PBIL Back to PBIL home page